ELAC1

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
ELAC1
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

3ZWF

Identifikatori
AliasiELAC1
Vanjski ID-jeviOMIM: 608079 MGI: 1890495 HomoloGene: 10272 GeneCards: ELAC1
Lokacija gena (čovjek)
Hromosom 18 (čovjek)
Hrom.Hromosom 18 (čovjek)[1]
Hromosom 18 (čovjek)
Genomska lokacija za ELAC1
Genomska lokacija za ELAC1
Bend18q21.2Početak50,967,991 bp[1]
Kraj50,988,121 bp[1]
Lokacija gena (miš)
Hromosom 18 (miš)
Hrom.Hromosom 18 (miš)[2]
Hromosom 18 (miš)
Genomska lokacija za ELAC1
Genomska lokacija za ELAC1
Bend18|18 E2Početak73,735,038 bp[2]
Kraj73,754,479 bp[2]
Obrazac RNK ekspresije
PBB GE ELAC1 219325 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija nuclease activity
endonuclease activity
3'-tRNA processing endoribonuclease activity
hydrolase activity
metal ion binding
endoribonuclease activity, producing 5'-phosphomonoesters
Ćelijska komponenta citoplazma
citosol
Jedro
Biološki proces tRNA 3'-trailer cleavage
RNA phosphodiester bond hydrolysis, endonucleolytic
tRNA processing
tRNA 3'-trailer cleavage, endonucleolytic
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_018696

NM_053255

RefSeq (bjelančevina)

NP_061166

NP_444485

Lokacija (UCSC)Chr 18: 50.97 – 50.99 MbChr 18: 73.74 – 73.75 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

ELAC protein 1 cink-fosfodiesteraze je enzim koji je kod ljudi kodiran genom ELAC1.[5][6]

Aminokiselinska sekvenca

Simboli
1020304050
MSMDVTFLGTGAAYPSPTRGASAVVLRCEGECWLFDCGEGTQTQLMKSQL
KAGRITKIFITHLHGDHFFGLPGLLCTISLQSGSMVSKQPIEIYGPVGLR
DFIWRTMELSHTELVFHYVVHELVPTADQCPAEELKEFAHVNRADSPPKE
EQGRTILLDSEENSYLLFDDEQFVVKAFRLFHRIPSFGFSVVEKKRPGKL
NAQKLKDLGVPPGPAYGKLKNGISVVLENGVTISPQDVLKKPIVGRKICI
LGDCSGVVGDGGVKLCFEADLLIHEATLDDAQMDKAKEHGHSTPQMAATF
AKLCRAKRLVLTHFSQRYKPVALAREGETDGIAELKKQAESVLDLQEVTL
AEDFMVISIPIKK

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000141642 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000036941 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Takaku H, Minagawa A, Takagi M, Nashimoto M (Apr 2003). "A candidate prostate cancer susceptibility gene encodes tRNA 3' processing endoribonuclease". Nucleic Acids Res. 31 (9): 2272–8. doi:10.1093/nar/gkg337. PMC 154223. PMID 12711671.
  6. ^ "Entrez Gene: ELAC1 elaC homolog 1 (E. coli)".

Dopunska literatura[uredi | uredi izvor]