FAM69C

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
DIPK1C
Identifikatori
AliasiDIPK1C
Vanjski ID-jeviOMIM: 614544 MGI: 3041188 HomoloGene: 45477 GeneCards: DIPK1C
Lokacija gena (čovjek)
Hromosom 18 (čovjek)
Hrom.Hromosom 18 (čovjek)[1]
Hromosom 18 (čovjek)
Genomska lokacija za DIPK1C
Genomska lokacija za DIPK1C
Bend18q22.3Početak74,434,775 bp[1]
Kraj74,457,944 bp[1]
Lokacija gena (miš)
Hromosom 18 (miš)
Hrom.Hromosom 18 (miš)[2]
Hromosom 18 (miš)
Genomska lokacija za DIPK1C
Genomska lokacija za DIPK1C
Bend18|18 E4Početak84,719,236 bp[2]
Kraj84,740,436 bp[2]
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001044369

NM_173770

RefSeq (bjelančevina)

NP_001037834

NP_776131

Lokacija (UCSC)Chr 18: 74.43 – 74.46 MbChr 18: 84.72 – 84.74 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Član C porodice proteina sa sličnošću sekvence 69 je protein koji je kod ljudi kodiran genom FAM69C.[5]

Dužina polipeptidnog lanca je 419 aminokiselina, a molekulska masa — 46.420[6].

Aminokiselinska sekvenca

Simboli
1020304050
MARAAGARGPAGWCRRRGRCGRGTLLAFAAWTAGWVLAAALLLRAHPGVL
SERCTDEKSRRILAALCQDYQGGTLAGDLCEDLCVAGELLFQRCLHYNRG
KKVLQADWRGRPVVLKSKEEAFSSFPPLSLLEEEAGEGGQDMPEAELLLM
VAGEVKSALGLELSNSSLGPWWPGRRGPRWRGQLASLWALLQQEEYVYFS
LLQDLSPHVLPVLGSCGHFYAVEFLAAGSPHHRALFPLDRAPGAPGGGQA
KAISDIALSFLDMVNHFDSDFSHRLHLCDIKPENFAIRSDFTVVAIDVDM
AFFEPKMREILEQNCTGDEDCNFFDCFSRCDLRVNKCGAQRVNNNLQVIC
DKIFRHWFSAPLKSSAVSFQLQLQLQEAVQECADPGVPSGNTRRAASSVF
WKLRQLLQATLRELQEAEK

Funkcija[uredi | uredi izvor]

Ovaj gen kodira člana FAM69 porodice cisteinom bogatog transmembranskog proteina tipa II. Ti proteini lokaliziraju se u endoplazmatski retikulum, ali njihove specifične funkcije nisu poznate.

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000187773 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000047992 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Family with sequence similarity 69, member C".
  6. ^ "UniProt". Pristupljeno 12. 9. 2017.

Dopunska literatura[uredi | uredi izvor]

  • Tennant-Eyles AJ, Moffitt H, Whitehouse CA, Roberts RG (mart 2011). "Characterisation of the FAM69 family of cysteine-rich endoplasmic reticulum proteins". Biochemical and Biophysical Research Communications. 406 (3): 471–7. doi:10.1016/j.bbrc.2011.02.076. PMID 21334309.