GBP1

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
GBP1
Protein GBP1 PDB 1dg3.png
Dostupne strukture
PDBPretraga Human UniProta: PDBe RCSB
Spisak PDB ID kodova

1DG3, 1F5N, 2B8W, 2B92, 2BC9, 2D4H

Identifikatori
AliasiGBP1
Vanjski ID-jeviOMIM: 600411 HomoloGene: 133759 GeneCards: GBP1
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za GBP1
Genomska lokacija za GBP1
Bend1p22.2Početak89,051,882 bp[1]
Kraj89,065,360 bp[1]
Obrazac RNK ekspresije
PBB GE GBP1 202270 at fs.png

PBB GE GBP1 202269 x at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija nucleotide binding
Hsp90 protein binding
spectrin binding
GO:0001948 protein binding
identical protein binding
enzyme binding
actin binding
hydrolase activity
cytokine binding
GO:0006184 GTPase activity
GTP binding
GDP binding
protein homodimerization activity
Ćelijska komponenta citosol
membrana
Golđijeva membrana
Ćelijska membrana
extracellular region
citoplazma
Golđijev aparat
vesicle membrane
actin cytoskeleton
GO:0016023 citoplazmatska vezikula
Biološki proces immune system process
interferon-gamma-mediated signaling pathway
negative regulation of T cell receptor signaling pathway
negative regulation of protein localization to plasma membrane
defense response to virus
regulation of calcium-mediated signaling
negative regulation of ERK1 and ERK2 cascade
negative regulation of substrate adhesion-dependent cell spreading
regulation of protein localization to plasma membrane
protein homooligomerization
cellular response to interferon-gamma
cellular response to interleukin-1
cellular response to tumor necrosis factor
protein localization to vacuole
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_002053

n/a

RefSeq (bjelančevina)

NP_002044

n/a

Lokacija (UCSC)Chr 1: 89.05 – 89.07 Mbn/a
PubMed pretraga[2]n/a
Wikipodaci
Pogledaj/uredi – čovjek

Interferonski-inducirani gvanilat-vezujući protein 1 jest protein koji je kod ljudi kodiran genom GBP1 sa hromosoma 1.[3][4] Pripada dinaminskoj natporodici velikih GTPaza.[5]

Amiokiselininska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 592 aminokiseline, a molekulska težina 67.931 Da.[6].

1020304050
MASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTG
KSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHPKKPGHILVLLDTEG
LGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTH
RIRSKSSPDENENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDE
YLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQL
EKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTY
VNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTETL
QELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQLEKKRDDFCKQNQ
EASSDRCSALLQVIFSPLEEEVKAGIYSKPGGYRLFVQKLQDLKKKYYEE
PRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIEVERVKAESAQ
ASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTL
ALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRRRKACTIS

Funkcija[uredi | uredi izvor]

Gvanilatna ekspresija vezivnog proteina indukovana je interferonom. Proteini koji se vezuju za gvanilat karakteriše njihova sposobnost da specifično vežu nukleotide guanina (GMP, GDP i GTP) i razlikuju se od GTP-vezujućih proteina po prisustvu dva motiva vezivanja, a ne tri.[4]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000117228 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ Strehlow I, Lohmann-Matthes ML, Decker T (Aug 1994). "The interferon-inducible GBP1 gene: structure and mapping to human chromosome 1". Gene. 144 (2): 295–9. doi:10.1016/0378-1119(94)90393-X. PMID 7518790.
  4. ^ a b "Entrez Gene: GBP1 guanylate binding protein 1, interferon-inducible, 67kDa".
  5. ^ Praefcke GJ, McMahon HT (February 2004). "The dynamin superfamily: universal membrane tubulation and fission molecules?". Nat. Rev. Mol. Cell Biol. 5 (2): 133–47. doi:10.1038/nrm1313. PMID 15040446. S2CID 6305282.
  6. ^ "UniProt, P32455" (jezik: eng.). Pristupljeno 2021-11-27. CS1 održavanje: nepreporučeni parametar (link) CS1 održavanje: nepoznati jezik (link)

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]