MCPH1

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
MCPH4
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

3T1N, 3SHT, 2WT8, 3SHV, 3U3Z, 3KTF, 3PA6, 3SZM

Identifikatori
AliasiMCPH1
Vanjski ID-jeviOMIM: 607117 MGI: 2443308 HomoloGene: 32586 GeneCards: MCPH1
Lokacija gena (čovjek)
Hromosom 8 (čovjek)
Hrom.Hromosom 8 (čovjek)[1]
Hromosom 8 (čovjek)
Genomska lokacija za MCPH4
Genomska lokacija za MCPH4
Bend8p23.1Početak6,406,592 bp[1]
Kraj6,648,508 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za MCPH4
Genomska lokacija za MCPH4
Bend8|8 A1.3Početak18,595,131 bp[2]
Kraj18,803,189 bp[2]
Ontologija gena
Molekularna funkcija GO:0001948 protein binding
identical protein binding
Ćelijska komponenta citoplazma
citoskelet
Nukleoplazma
centar organizacije mikrotubula
Biološki proces cerebral cortex development
establishment of mitotic spindle orientation
Regulacija ekspresije gena
regulation of kinase activity
regulation of centrosome cycle
regulation of inflammatory response
bone development
regulation of chromosome condensation
protein localization to centrosome
neuronal stem cell population maintenance
negative regulation of transcription by RNA polymerase II
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_001172574
NM_001172575
NM_024596
NM_001322042
NM_001322043

NM_001322045
NM_001363979
NM_001363980

NM_173189

RefSeq (bjelančevina)
NP_001166045
NP_001166046
NP_001308971
NP_001308972
NP_001308974

NP_078872
NP_001350908
NP_001350909

NP_775281

Lokacija (UCSC)Chr 8: 6.41 – 6.65 MbChr 8: 18.6 – 18.8 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Mikrocefalinski protein
Identifikatori
SimbolMikrocefalin

Mikrocefalin (MCPH1) je gen koji se eksprimira tokom fetusnog razvoja mozga. Određene mutacije u MCPH1 u homozigotnom stanju, uzrokuju primarnu mikrocefaliju – jako smanjeni mozak.[5] Zato se pretpostavlja da njegove varijante imaju ulogu u razvoju mozga. Međutim, kod normalnih osoba još nije dokazan uticaj na mentalnu sposobnost ili ponašanje ni u ovom ni u drugom slično proučenom genu mikrocefalije, ASPM.[6][7] Međutim, uspostavljena je povezanost između normalnih varijacija u strukturi mozga, kao mjereno s MRI (tj., prvenstveno korteksna površina i ukupna zapremina mozga), ali samo kod žena, i uobičajenih genetičkih varijanti unutar gena MCPH1 i drugog slično proučenog gena za mikrocefaliju, CDK5RAP2.[8]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 835 aminokiselina, a molekulska težina 92.849 Da.[9]

1020304050
MAAPILKDVVAYVEVWSSNGTENYSKTFTTQLVDMGAKVSKTFNKQVTHV
IFKDGYQSTWDKAQKRGVKLVSVLWVEKCRTAGAHIDESLFPAANMNEHL
SSLIKKKRKCMQPKDFNFKTPENDKRFQKKFEKMAKELQRQKTNLDDDVP
ILLFESNGSLIYTPTIEINSRHHSAMEKRLQEMKEKRENLSPTSSQMIQQ
SHDNPSNSLCEAPLNISRDTLCSDEYFAGGLHSSFDDLCGNSGCGNQERK
LEGSINDIKSDVCISSLVLKANNIHSSPSFTHLDKSSPQKFLSNLSKEEI
NLQRNIAGKVVTPDQKQAAGMSQETFEEKYRLSPTLSSTKGHLLIHSRPR
SSSVKRKRVSHGSHSPPKEKCKRKRSTRRSIMPRLQLCRSEDRLQHVAGP
ALEALSCGESSYDDYFSPDNLKERYSENLPPESQLPSSPAQLSCRSLSKK
ERTSIFEMSDFSCVGKKTRTVDITNFTAKTISSPRKTGNGEGRATSSCVT
SAPEEALRCCRQAGKEDACPEGNGFSYTIEDPALPKGHDDDLTPLEGSLE
EMKEAVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKE
NLPGGYSGSVKNRPTRHDVLDDSCDGFKDLIKPHEELKKSGRGKKPTRTL
VMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLG
IARGCWVLSYDWVLWSLELGHWISEEPFELSHHFPAAPLCRSECHLSAGP
YRGTLFADQPAMFVSPASSPPVAKLCELVHLCGGRVSQVPRQASIVIGPY
SGKKKATVKYLSEKWVLDSITQHKVCAPENYLLSQ
Simboli

Struktura[uredi | uredi izvor]

Proteini mikrocefalina sadrže sljedeća tri domena:

Izražavanje u mozgu[uredi | uredi izvor]

MCPH1 se eksprimira u fetusnom mozgu, u prednjem mozgu] u razvoju i na zidovima bočne komore. Ćelije ovog područja dijele se, stvarajući neurone koji migriraju da bi na kraju formirali koru velikog mozga.

Evolucija[uredi | uredi izvor]

Izvedeni oblik MCPH1 pojavio se prije otprilike 37.000 godina (bilo kada između 14.000 i 60.000 godina) i proširio se i postao najčešći oblik mikrocefalina u cijelom svijetu, osim Subsaharske Afrike; ovo brzo širenje sugerira selekcijski zamah.[10][11] Međutim, naučnici nisu identificirali evolucijski pritisak koji je možda uzrokovao širenje ovih mutacija.[12] Smatra se da ova varijanta gena doprinosi povećanom volumenu mozga,[13] i može biti u korelaciji sa učestalošću tonskih jezika,[14] iako moderna raspodjela hromosoma koji nose predačke forme MCPH1 i ASPM nije pokazala da mikrocefalin ili ASPM imaju bilo kakav značajan efekat na IQ.[15]

Izvedeni oblik MCPH1 možda potiče iz loze koja je odvojena od modernih ljudi prije otprilike 1,1 milion godina, a kasnije ukljućena u ljude. Ovo otkriće govori u prilog mogućnosti primjesa između modernih ljudi i izumrlog Homo spp.[11] Dok su neandertalci predložen kao mogući izvor ovog haplotipa, haplotip nije pronađen kod osoba korištenih za pripremu prvog nacrta neandertalskog genoma.[16][17]

Modelni organizmi[uredi | uredi izvor]

Fenotip nokaut-miša Pnpo
Svojstvo Fenotip
Vijabilnost homozigota Nenormalno
Studija recesivne letalnosti Nenormalno
Plodnost Nenormano
Tjelesna težina Normalno
Test otvorenog polja: anksioznost Normalno
Neurološka procjena Normalno
Snaga stiska Normalno
Test vruće ploče Normalno
Dismorfologija Normalno
Indirektna kalorimetrija Normalno
Test tolerancije glukoze Normalno
Slušni odgovor moždanog stabla Nenormalno
DEXA Normalno
Radiografija Normalno
Tjelesna temperatura Normalno
Morfologija oka Normalno
Klinička hemija (nalaz) Normalno
Plazmatski imunoglobulini Nenormalno
Hematologija Normalno
Leukociti periferne krvi Normalno
Mikronukleus test Nenormalno
Težina srca Normalno
Histopatologija oka Nenormalno
Salmonella infekcija Normal[18]
Citrobacter infekcija Normal[19]
Svi testovi i analize su iz [20][21]

U proučavanju PNPO funkcije, korišteni su modelni organizmi. Uvjetna linija nokaut- miševa, zvana Pnpotm1a (KOMP) Wtsi,[22][23] generirana je kao dio programa Međunarosnog konzorcija za miševe – visokopropusnog projekta mutageneze za generiranje i distribuciju životinjskih modela bolesti zainteresiranim naučnicima.[24][25][26]

Muške i ženske životinje prolazile su standardizirani fenotipski skrining, kako bi se utvrdili efekti delecije.[20][27] Od 24 izvedena testa ina mutantnim miševima, uočene su dvije značajne abnormalnosti.[20] Tokom gestacije, nije utvrđen homozigotni mutantni embrion, pa tako nijedan nije preživio do odvikavanja. Preostali testovi su izvedeni na mutiranim heterozigotnim odraslim miševima; nisu opažene nikakve dodatne značajne abnormalnosti kod ovih životinja. [20]

Ostali MCPH geni[uredi | uredi izvor]

Pored MCPH1, drugi geni su određeni kao MCPH geni na osnovu njihove uloge u osdređivanju veličine mozga. Uključuju WDR62 (MCPH2), CDK5RAP2 (MCPH3), KNL1 (MCPH4), ASPM (MCPH5), CENPJ (MCPH6), STIL (MCPH7), CEP135 (MCPH8), CEP152 (MCPH9), ZNF335 (MCPH10), PHC1 (MCPH11) i CDK6 (MCPH12).[28]

Istraživačke studije[uredi | uredi izvor]

U martu 2019., kineski naučnici izvijestili su o inserciji gena MCPH1 povezanog s ljudskim mozgom rezus-majmunima u laboratorijskim uvjetima, što je rezultiralo boljim performansama transgenih majmuna i bržim odgovaranjem na "testovima kratkoročne memorije koji uključuju podudaranje boja i oblika", u poređenju sa netransgenim majmunima, prema istraživačima.[29][30]

Također pogledajta[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ a b c ENSG00000285262 GRCh38: Ensembl release 89: ENSG00000147316, ENSG00000285262 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000039842 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ OMIM: 251200 251200
  6. ^ Woods RP, Freimer NB, De Young JA, Fears SC, Sicotte NL, Service SK, Valentino DJ, Toga AW, Mazziotta JC (June 2006). "Normal variants of Microcephalin and ASPM do not account for brain size variability". Human Molecular Genetics. 15 (12): 2025–9. doi:10.1093/hmg/ddl126. PMID 16687438.
  7. ^ Rushton JP, Vernon PA, Bons TA (April 2007). "No evidence that polymorphisms of brain regulator genes Microcephalin and ASPM are associated with general mental ability, head circumference or altruism". Biology Letters. 3 (2): 157–60. doi:10.1098/rsbl.2006.0586. PMC 2104484. PMID 17251122.
  8. ^ Rimol LM, Agartz I, Djurovic S, Brown AA, Roddey JC, Kähler AK, Mattingsdal M, Athanasiu L, Joyner AH, Schork NJ, Halgren E, Sundet K, Melle I, Dale AM, Andreassen OA (January 2010). "Sex-dependent association of common variants of microcephaly genes with brain structure". Proceedings of the National Academy of Sciences of the United States of America. 107 (1): 384–8. Bibcode:2010PNAS..107..384R. doi:10.1073/pnas.0908454107. JSTOR 40536283. PMC 2806758. PMID 20080800.
  9. ^ "UniProt, Q8NEM0". Pristupljeno 2021-07-16. CS1 održavanje: nepreporučeni parametar (link)
  10. ^ Evans PD, Gilbert SL, Mekel-Bobrov N, Vallender EJ, Anderson JR, Vaez-Azizi LM, Tishkoff SA, Hudson RR, Lahn BT (September 2005). "Microcephalin, a gene regulating brain size, continues to evolve adaptively in humans". Science. 309 (5741): 1717–20. Bibcode:2005Sci...309.1717E. doi:10.1126/science.1113722. PMID 16151009. S2CID 85864492. SažetakThe New York Times (September 8, 2005).
  11. ^ a b Evans PD, Mekel-Bobrov N, Vallender EJ, Hudson RR, Lahn BT (November 2006). "Evidence that the adaptive allele of the brain size gene microcephalin introgressed into Homo sapiens from an archaic Homo lineage". Proceedings of the National Academy of Sciences of the United States of America. 103 (48): 18178–83. Bibcode:2006PNAS..10318178E. doi:10.1073/pnas.0606966103. JSTOR 30051829. PMC 1635020. PMID 17090677.
  12. ^ Mekel-Bobrov N, Posthuma D, Gilbert SL, Lind P, Gosso MF, Luciano M, et al. (March 2007). "The ongoing adaptive evolution of ASPM and Microcephalin is not explained by increased intelligence". Human Molecular Genetics. 16 (6): 600–8. doi:10.1093/hmg/ddl487. PMID 17220170.
  13. ^ Lari M, Rizzi E, Milani L, Corti G, Balsamo C, Vai S, Catalano G, Pilli E, Longo L, Condemi S, Giunti P, Hänni C, De Bellis G, Orlando L, Barbujani G, Caramelli D (May 2010). "The microcephalin ancestral allele in a Neanderthal individual". PLOS ONE. 5 (5): e10648. Bibcode:2010PLoSO...510648L. doi:10.1371/journal.pone.0010648. PMC 2871044. PMID 20498832.
  14. ^ Dediu D, Ladd DR (June 2007). "Linguistic tone is related to the population frequency of the adaptive haplogroups of two brain size genes, ASPM and Microcephalin". Proceedings of the National Academy of Sciences of the United States of America. 104 (26): 10944–9. Bibcode:2007PNAS..10410944D. doi:10.1073/pnas.0610848104. JSTOR 25436044. PMC 1904158. PMID 17537923.
  15. ^ Mekel-Bobrov N, Posthuma D, Gilbert SL, Lind P, Gosso MF, Luciano M, et al. (March 2007). "The ongoing adaptive evolution of ASPM and Microcephalin is not explained by increased intelligence". Human Molecular Genetics. 16 (6): 600–8. doi:10.1093/hmg/ddl487. PMID 17220170.
  16. ^ Pennisi E (February 2009). "Neandertal genomics. Tales of a prehistoric human genome". Science. 323 (5916): 866–71. doi:10.1126/science.323.5916.866. PMID 19213888. S2CID 206584252.
  17. ^ Green RE, Krause J, Briggs AW, Maricic T, Stenzel U, Kircher M, et al. (May 2010). "A draft sequence of the Neandertal genome". Science. 328 (5979): 710–722. Bibcode:2010Sci...328..710G. doi:10.1126/science.1188021. PMC 5100745. PMID 20448178.
  18. ^ "Salmonella infection data for Pnpo". Wellcome Trust Sanger Institute.
  19. ^ "Citrobacter infection data for Pnpo". Wellcome Trust Sanger Institute.
  20. ^ a b c d Gerdin AK (2010). "The Sanger Mouse Genetics Programme: High throughput characterisation of knockout mice". Acta Ophthalmologica. 88: 925–7. doi:10.1111/j.1755-3768.2010.4142.x. S2CID 85911512.
  21. ^ Mouse Resources Portal, Wellcome Trust Sanger Institute.
  22. ^ "International Knockout Mouse Consortium". Arhivirano s originala, 3. 4. 2012. Pristupljeno 16. 7. 2021.
  23. ^ "Mouse Genome Informatics".
  24. ^ Skarnes, W. C.; Rosen, B.; West, A. P.; Koutsourakis, M.; Bushell, W.; Iyer, V.; Mujica, A. O.; Thomas, M.; Harrow, J.; Cox, T.; Jackson, D.; Severin, J.; Biggs, P.; Fu, J.; Nefedov, M.; De Jong, P. J.; Stewart, A. F.; Bradley, A. (2011). "A conditional knockout resource for the genome-wide study of mouse gene function". Nature. 474 (7351): 337–342. doi:10.1038/nature10163. PMC 3572410. PMID 21677750.
  25. ^ Dolgin E (2011). "Mouse library set to be knockout". Nature. 474 (7351): 262–3. doi:10.1038/474262a. PMID 21677718.
  26. ^ Collins FS, Rossant J, Wurst W (2007). "A Mouse for All Reasons". Cell. 128 (1): 9–13. doi:10.1016/j.cell.2006.12.018. PMID 17218247. S2CID 18872015.
  27. ^ van der Weyden L, White JK, Adams DJ, Logan DW (2011). "The mouse genetics toolkit: revealing function and mechanism". Genome Biol. 12 (6): 224. doi:10.1186/gb-2011-12-6-224. PMC 3218837. PMID 21722353.
  28. ^ Faheem M, Naseer MI, Rasool M, Chaudhary AG, Kumosani TA, Ilyas AM, et al. (2015-01-15). "Molecular genetics of human primary microcephaly: an overview". BMC Medical Genomics. 8 Suppl 1 (Suppl 1): S4. doi:10.1186/1755-8794-8-S1-S4. PMC 4315316. PMID 25951892.
  29. ^ Burrell T (29 December 2019). "Scientists Put a Human Intelligence Gene Into a Monkey. Other Scientists are Concerned". Discover. Pristupljeno 30 December 2019.
  30. ^ Shi, Lei; et al. (27 March 2019). "Transgenic rhesus monkeys carrying the human MCPH1 gene copies show human-like neoteny of brain development". Chinese National Science Review. 6 (3): 480–493. doi:10.1093/nsr/nwz043.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]