MGAT5B

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
MGAT5B
Identifikatori
AliasiMGAT5B
Vanjski ID-jeviOMIM: 612441 MGI: 3606200 HomoloGene: 27821 GeneCards: MGAT5B
Lokacija gena (čovjek)
Hromosom 17 (čovjek)
Hrom.Hromosom 17 (čovjek)[1]
Hromosom 17 (čovjek)
Genomska lokacija za MGAT5B
Genomska lokacija za MGAT5B
Bend17q25.2Početak76,868,404 bp[1]
Kraj76,950,393 bp[1]
Lokacija gena (miš)
Hromosom 11 (miš)
Hrom.Hromosom 11 (miš)[2]
Hromosom 11 (miš)
Genomska lokacija za MGAT5B
Genomska lokacija za MGAT5B
Bend11|11 E2Početak116,918,863 bp[2]
Kraj116,986,948 bp[2]
Ontologija gena
Molekularna funkcija transferase activity
GO:0001948 protein binding
metal ion binding
transferase activity, transferring glycosyl groups
alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity
manganese ion binding
Ćelijska komponenta integral component of membrane
Golđijeva membrana
membrana
Golđijev aparat
Biološki proces protein glycosylation
protein N-linked glycosylation
protein O-linked glycosylation via serine
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001199172
NM_144677
NM_198955

NM_172948

RefSeq (bjelančevina)

NP_001186101
NP_653278
NP_945193

NP_766536

Lokacija (UCSC)Chr 17: 76.87 – 76.95 MbChr 11: 116.92 – 116.99 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Alfa-1,6-manozilglikoprotein 6-beta-N-acetilglukozaminiltransferaza B je enzim koji je kod ljudi koditran genom MGAT5B.[5][6][7]

Dužina polipeptidnog lanca je 792 aminokiseline, sa molekulskom težinom od 89.535.[8]

Aminokiselinska sekvenca

Simboli
1020304050
MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRL
GDSPFTIRTEVMGGPESRGVLRKMSDLLELMVKRMDALARLENSSELHRA
GGDLHFPADRMPPGAGLMERIQAIAQNVSDIAVKVDQILRHSLLLHSKVS
EGRRDQCEAPSDPKFPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIY
LSEVEWFCPPLPWRNQTAAQRAPKPLPKVQAVFRSNLSHLLDLMGSGKES
LIFMKKRTKRLTAQWALAAQRLAQKLGATQRDQKQILVHIGFLTEESGDV
FSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQSNLGVPPGR
GSCPLTMPLPFDLIYTDYHGLQQMKRHMGLSFKKYRCRIRVIDTFGTEPA
YNHEEYATLHGYRTNWGYWNLNPKQFMTMFPHTPDNSFMGFVSEELNETE
KRLIKGGKASNMAVVYGKEASIWKLQGKEKFLGILNKYMEIHGTVYYESQ
RPPEVPAFVKNHGLLPQPEFQQLLRKAKLFIGFGFPYEGPAPLEAIANGC
IFLQSRFSPPHSSLNHEFFRGKPTSREVFSQHPYAENFIGKPHVWTVDYN
NSEEFEAAIKAIMRTQVDPYLPYEYTCEGMLERIHAYIQHQDFCRAPDPA
LPEAHAPQSPFVLAPNATHLEWARNTSLAPGAWPPAHALRAWLAVPGRAC
TDTCLDHGLICEPSFFPFLNSQDAFLKLQVPCDSTESEMNHLYPAFAQPG
QECYLQKEPLLFSCAGSNTKYRRLCPCRDFRKGQVALCQGCL

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000167889 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000043857 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Inamori K, Endo T, Gu J, Matsuo I, Ito Y, Fujii S, Iwasaki H, Narimatsu H, Miyoshi E, Honke K, Taniguchi N (Jan 2004). "N-Acetylglucosaminyltransferase IX acts on the GlcNAc beta 1,2-Man alpha 1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan". J Biol Chem. 279 (4): 2337–2340. doi:10.1074/jbc.C300480200. PMID 14617637.
  6. ^ Kaneko M, Alvarez-Manilla G, Kamar M, Lee I, Lee JK, Troupe K, Zhang W, Osawa M, Pierce M (Nov 2003). "A novel beta(1,6)-N-acetylglucosaminyltransferase V (GnT-VB)(1)". FEBS Lett. 554 (3): 515–519. doi:10.1016/S0014-5793(03)01234-1. PMID 14623122. S2CID 82207739.
  7. ^ "Entrez Gene: MGAT5B mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase, isozyme B".
  8. ^ "UniProt, Q3V5L5". Pristupljeno 12. 9. 2017.

Dopunska literatura[uredi | uredi izvor]