SF3B5

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
SF3B5
Identifikatori
AliasiSF3B5
Vanjski ID-jeviOMIM: 617847 MGI: 1913375 HomoloGene: 41825 GeneCards: SF3B5
Lokacija gena (čovjek)
Hromosom 6 (čovjek)
Hrom.Hromosom 6 (čovjek)[1]
Hromosom 6 (čovjek)
Genomska lokacija za SF3B5
Genomska lokacija za SF3B5
Bend6q24.2Početak144,094,884 bp[1]
Kraj144,095,573 bp[1]
Obrazac RNK ekspresije
PBB GE SF3B5 221263 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija RNA binding
Ćelijska komponenta U12-type spliceosomal complex
spliceosomal complex
precatalytic spliceosome
Jedro
U2 snRNP
Nukleoplazma
U2-type precatalytic spliceosome
Biološki proces mRNA processing
Prerada RNK
mRNA splicing, via spliceosome
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_031287

NM_175102

RefSeq (bjelančevina)

NP_112577

NP_780311

Lokacija (UCSC)Chr 6: 144.09 – 144.1 Mbn/a
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Podjedinica 5 splajsing faktora 3B jest protein koji je kod ljudi kodiran genom SF3B5.[4][5]

Pladienolid, herboksidien i spajsostatin identificirani su kao modulatori prerade RNK koji ciljaju SF3B u potkompleksu SF3b. U jednom radu iz 2017. izvješteno je da je PHF5A, još jedna komponenta ovog potkompleksa, također meta ovih spojeva. Mutacije u PHF5A-Y36, SF3B -K 07 , SF3B -R 074 i SF3B -V 078 daju otpor ovim modulatorima, što ukazuje na zajedničko mjesto interakcije. RNK-seq analiza otkriva da PHF5A-Y36C ima minimalan učinak na baznu preradu, ali inhibira globalno djelovanje modulatora prerade. Štaviše, PHF5A-Y36C mijenja profil zadržavanja introna induciranog splajsingom/preskakanjem egzona, koji je povezan sa diferencijalnim sadržajem GC-a između susjednih introna i egzona.

Određena je kristalna struktura ljudskog PHF5A, pokazujući da se Y36 nalazi u visoko konzerviranoj regiji. Analiza krio-EM splajsosomskog kompleksa Bact pokazuje da se rezistencijske mutacije grupiraju u džepu koji okružuje adenozinske tačke grananja, što ukazuje na konkurentan način djelovanja. Zajedno, predloženo je da PHF5A-SF3B čini centralni čvor za vezivanje za ove modulatore splajsinga.[6]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 86 aminokiselina, а molekulska težina 0,35 Da.[7]

=

020304050
MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLL
NYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000169976 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ Will CL, Urlaub H, Achsel T, Gentzel M, Wilm M, Luhrmann R (Sep 2002). "Characterization of novel SF3b and 17S U2 snRNP proteins, including a human Prp5p homologue and an SF3b DEAD-box protein". EMBO J. 21 (18): 4978–88. doi:10.1093/emboj/cdf480. PMC 126279. PMID 12234937.
  5. ^ "Entrez Gene: SF3B5 splicing factor 3b, subunit 5, 10kDa".
  6. ^ Teng Teng, Jennifer Hc Tsai, Xiaoling Puyang, Michael Seiler, Shouyong Peng, Sudeep Prajapati, Daniel Aird, Silvia Buonamici, Benjamin Caleb, Betty Chan, Laura Corson, Jacob Feala, Peter Fekkes, Baudouin Gerard, Craig Karr, Manav Korpal, Xiang Liu, Jason T Lowe, Yoshiharu Mizui, James Palacino, Eunice Park, Peter G Smith, Vanitha Subramanian, Zhenhua Jeremy Wu, Jian Zou, Lihua Yu , Agustin Chicas, Markus Warmuth, Nicholas Larsen, Ping Zhu (2017): Splicing modulators act at the branch point adenosine binding pocket defined by the PHF5A-SF3b complex. Nat Commun, 25(8): 5522; pmid: 2854 300: pmcid: pmc54585 9; doi: 0. 038/ncomms 5522
  7. ^ "UniProt, Q9BWJ5" (jezik: engleski). Pristupljeno 10. 10. 2021.

Dopunska literatura[uredi | uredi izvor]