SSCEL

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
SSCEL
Identifikatori
AliasiSCEL
Vanjski ID-jeviOMIM: 604112 MGI: 1891228 HomoloGene: 2850 GeneCards: SCEL
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za SSCEL
Genomska lokacija za SSCEL
Bend13q22.3Početak77,535,674 bp[1]
Kraj77,645,263 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za SSCEL
Genomska lokacija za SSCEL
Bend14|14 E2.3Početak103,750,778 bp[2]
Kraj103,850,233 bp[2]
Obrazac RNK ekspresije
PBB GE SCEL 206884 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 protein binding
metal ion binding
Ćelijska komponenta citoplazma
Egzosom
membrana
cornified envelope
perinuklearno područje citoplazme
Biološki proces embryo development
epidermis development
keratinocyte differentiation
response to mechanical stimulus
positive regulation of canonical Wnt signaling pathway
embryo development ending in birth or egg hatching
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001160706
NM_003843
NM_144777

NM_022886

RefSeq (bjelančevina)

NP_001154178
NP_003834
NP_659001

NP_075024

Lokacija (UCSC)Chr 13: 77.54 – 77.65 MbChr 14: 103.75 – 103.85 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Scijelin je protein koji je kod ljudi kodiran genom SCEL.[5][6]

Protein kodiran ovim genom je prekursor orožnjalog omotača terminalno diferenciranih keratinocita. Ovaj protein se lokalizira na periferiji ćelija i može funkcionirati u sastavljanju ili regulaciji proteina u rožnoj ovojnici. Postoje varijante transkripta koje kodiraju različite izoforme. Varijanta transkripta koja koristi alternativu polyA signal opisana je u literaturi, ali njena dužina nije utvrđena.[6]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 688 aminokiselina, a molekulska težina 77 552 Da.[7].

1020304050
MSNVTLRKMSPTGNEMKSTTQGTTRKQQDFHEVNKRRTFLQDNSWIKKRP
EEEKDENYGRVVLNRHNSHDALDRKVNERDVPKATISRYSSDDTLDRISD
RNDAAKTYKANTLDNQLTNRSMSMFRSLEVTKLQPGGSLNANTSNTIAST
SATTPVKKKRQSWFPPPPPGYNASSSTGTRRREPGVHPPIPPKPSSPVSS
PNQLRQDNRQIHPPKPGVYTETNRSAERNIRSQDLDNIVKVATSLQRSDK
GEELDNLIKMNKSLNRNQGLDSLFRANPKVEEREKRAKSLESLIYMSTRT
DKDGKGIQSLGSPIKVNQRTDKNEKGRQNLESVAKVNARMNKTSRRSEDL
DNATEVNPKGHENTTGKKDLDGLIKVDPETNKNITRGQSLDNLIKVTPEV
KRSNQGSKDLNNFIKVYPGTEKSTEGGQSLDSLIKVTPERNRTNQGNQDL
ENLIKVIPSANKSSEQGLDEHINVSPKAVKNTDGKQDLDKLIKVNPEIFT
NNQRNQDLANLIKVNPAVIRNNQSQDLDNLIKVKPSALRNTNRDQNLENL
IEVNSHVSENKNGSSNTGAKQAGPQDTVVYTRTYVENSKSPKDGYQENIS
GKYIQTVYSTSDRSVIERDMCTYCRKPLGVETKMILDELQICCHSTCFKC
EICKQPLENLQAGDSIWIYRQTIHCEPCYSKIMAKWIP
Simboli

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000136155 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000022123 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Champliaud MF, Burgeson RE, Jin W, Baden HP, Olson PF (Dec 1998). "cDNA cloning and characterization of sciellin, a LIM domain protein of the keratinocyte cornified envelope". J Biol Chem. 273 (47): 31547–54. doi:10.1074/jbc.273.47.31547. PMID 9813070.
  6. ^ a b "Entrez Gene: SCEL sciellin".
  7. ^ "UniProt, O95171". Pristupljeno 2021-08-05. CS1 održavanje: nepreporučeni parametar (link)

Dopunska literatura[uredi | uredi izvor]