CAB39L

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
CAB39L
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

3ZHP

Identifikatori
AliasiCAB39L
Vanjski ID-jeviOMIM: 612175 MGI: 1914081 HomoloGene: 69422 GeneCards: CAB39L
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za CAB39L
Genomska lokacija za CAB39L
Bend13q14.2Početak49,308,650 bp[1]
Kraj49,444,064 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za CAB39L
Genomska lokacija za CAB39L
Bend14|14 C3Početak59,678,421 bp[2]
Kraj59,823,213 bp[2]
Obrazac RNK ekspresije
PBB GE CAB39L 221003 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 protein binding
protein serine/threonine kinase activity
Ćelijska komponenta citosol
intracellular anatomical structure
Biološki proces GO:0072468 signal transduction
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001079670
NM_001287337
NM_001287338
NM_001287339
NM_030925

NM_026908
NM_001360591
NM_001360592
NM_001360593

RefSeq (bjelančevina)

NP_001073138
NP_001274266
NP_001274267
NP_001274268
NP_112187

NP_081184
NP_001347520
NP_001347521
NP_001347522

Lokacija (UCSC)Chr 13: 49.31 – 49.44 MbChr 14: 59.68 – 59.82 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Proteinoliki kalcij-vezujući protein 39 je protein koji je kod ljudi kodiran genom CAB39L.[5]

Hartz (2008) locirala je gen CAB39L na poziciji q14.2 hromosoma 13, na osnovu poravnavanja sekvence CAB39L (GenBank AX105381) sa genomskom sekvencom (36.1).[6]

Pretražujući baze podataka za sekvence slične MO25-alfa (CAB39), Boudeau et al. (2003) identificirali su CAB39L, koji su označili kao MO25-beta. Izvedeni protein sadrži 334 aminokiseline. Western blot analiza otkrila je ekspresiju MO25-beta u nekoliko tkiva miša i ćelijskih linija sisavra, uključujući ćelije bubrega ljudskog embriona.

Koristeći analizu koimunoprecipitacije, Boudeau et al. (2003) pokazali su da je MO25-beta u interakciji sa ekvimolarnim heterotrimernim proteinskim kompleksom sa serin/treonin kinazom LKB1 (STK11) i STRAD-alfa (LYK5) ili STRAD-beta (ALS2CR2). MO25-beta i STRAD-beta stabilizirani LKB1 u aktivnom kompleksu. Zaključili su da MO25-beta može funkcionirati kao komponenta kompleksa skele.[7]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 337 aminokiselina, a molekulska težina 39 088 Da.[8].

1020304050
MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMK
EILCGTNEKEPPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQI
FNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIALRCGIMLRECI
RHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVAD
FLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRHNFAIMTKYIS
KPENLKLMMNLLRDKSPNIQFEAFHVFKVFVASPHKTQPIVEILLKNQPK
LIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP
Simboli

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000102547 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000021981 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: CAB39L calcium binding protein 39-like". CS1 održavanje: nepreporučeni parametar (link)
  6. ^ Hartz, P. A. Personal Communication. Baltimore, Md. 7/1/2008.
  7. ^ Boudeau, J., Baas, A. F., Deak, M., Morrice, N. A., Kieloch, A., Schutkowski, M., Prescott, A. R., Clevers, H. C., Alessi, D. R. MO25-alpha/beta interact with STRAD-alpha/beta enhancing their ability to bind, activate and localize LKB1 in the cytoplasm. EMBO J. 22: 5102-5114, 2003. PubMed: 14517248
  8. ^ "UniProt, Q9H9S4". Pristupljeno 2017-09-11. CS1 održavanje: nepreporučeni parametar (link)

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]