FAM20A

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
FAM20A
Identifikatori
AliasiFAM20A
Vanjski ID-jeviOMIM: 611062 MGI: 2388266 HomoloGene: 9719 GeneCards: FAM20A
Lokacija gena (čovjek)
Hromosom 17 (čovjek)
Hrom.Hromosom 17 (čovjek)[1]
Hromosom 17 (čovjek)
Genomska lokacija za FAM20A
Genomska lokacija za FAM20A
Bend17q24.2Početak68,535,113 bp[1]
Kraj68,601,367 bp[1]
Lokacija gena (miš)
Hromosom 11 (miš)
Hrom.Hromosom 11 (miš)[2]
Hromosom 11 (miš)
Genomska lokacija za FAM20A
Genomska lokacija za FAM20A
Bend11|11 E1Početak109,669,749 bp[2]
Kraj109,722,279 bp[2]
Ontologija gena
Molekularna funkcija protein serine/threonine kinase activity
protein serine/threonine kinase activator activity
GO:0001948 protein binding
phosphotransferase activity, alcohol group as acceptor
Ćelijska komponenta extracellular region
Egzosom
Endoplazmatski retikulum
Vanćelijsko
Golđijev aparat
Biološki proces biomineral tissue development
enamel mineralization
positive regulation of protein phosphorylation
calcium ion homeostasis
tooth eruption
positive regulation of protein serine/threonine kinase activity
protein phosphorylation
response to bacterium
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001243746
NM_017565

NM_153782

RefSeq (bjelančevina)

NP_001230675
NP_060035

NP_722477

Lokacija (UCSC)Chr 17: 68.54 – 68.6 MbChr 11: 109.67 – 109.72 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

FAM20A je protein koji je kod ljudi kodiran genom FAM20A.[5]

Dužina polipeptidnog lanca je 541 aminokiselinu, sa molekulskom težinom od 61.417[6].

Aminokiselinska sekvenca

Simboli
1020304050
MPGLRRDRLLTLLLLGALLSADLYFHLWPQVQRQLRPRERPRGCPCTGRA
SSLARDSAAAASDPGTIVHNFSRTEPRTEPAGGSHSGSSSKLQALFAHPL
YNVPEEPPLLGAEDSLLASQEALRYYRRKVARWNRRHKMYREQMNLTSLD
PPLQLRLEASWVQFHLGINRHGLYSRSSPVVSKLLQDMRHFPTISADYSQ
DEKALLGACDCTQIVKPSGVHLKLVLRFSDFGKAMFKPMRQQRDEETPVD
FFYFIDFQRHNAEIAAFHLDRILDFRRVPPTVGRIVNVTKEILEVTKNEI
LQSVFFVSPASNVCFFAKCPYMCKTEYAVCGNPHLLEGSLSAFLPSLNLA
PRLSVPNPWIRSYTLAGKEEWEVNPLYCDTVKQIYPYNNSQRLLNVIDMA
IFDFLIGNMDRHHYEMFTKFGDDGFLIHLDNARGFGRHSHDEISILSPLS
QCCMIKKKTLLHLQLLAQADYRLSDVMRESLLEDQLSPVLTEPHLLALDR
RLQTILRTVEGCIVAHGQQSVIVDGPVEQLAPDSGQANLTS

Funkcija[uredi | uredi izvor]

FAM20A pripada porodici evolucijski konzerviranih lučenih proteina eksprimiranih u mnogim tkivima. Ovaj lokus kodira protein koji se vjerovatno luči i može funkcionirati u hematopoezi.[7] Mutacija na ovom lokusu povezana je sa bolešću amelogenesis imperfecta i sindromom hiperplazije desni (gingiva). Utvrđene su alternativno prerađene varijante transkripata. [RefSeq, avgust 2011.]

Klinički značaj[uredi | uredi izvor]

Izvješteno je da je mutacija u FAM20A povezana sa amelogenesis imperfecta, nasljednim defektom cakline i sindromom hiperplazija desni.[8]

Izvješteno je i da mutacije u FAM20A kod ljudi uzrokuju sindrom cakline i bubrega, autosomno recesivni poremećaj koji se karakterizira ozbiljnom hipoplazijom cakline, neuspjelom nicanjem zuba, intrapulpnim kalcifikacijama, povećanom gingivom i nefrokalcinozom.[9]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000108950 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000020614 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: family with sequence similarity 20".
  6. ^ "UniProt, Q96MK3". Pristupljeno 12. 9. 2017.
  7. ^ Nalbant D, Youn H, Nalbant SI, Sharma S, Cobos E, Beale EG, Du Y, Williams SC (2005). "FAM20: an evolutionarily conserved family of secreted proteins expressed in hematopoietic cells". BMC Genomics. 6 (1): 11. doi:10.1186/1471-2164-6-11. PMC 548683. PMID 15676076.
  8. ^ O'Sullivan J, Bitu CC, Daly SB, Urquhart JE, Barron MJ, Bhaskar SS, Martelli-Júnior H, dos Santos Neto PE, Mansilla MA, Murray JC, Coletta RD, Black GC, Dixon MJ (maj 2011). "Whole-Exome sequencing identifies FAM20A mutations as a cause of amelogenesis imperfecta and gingival hyperplasia syndrome". Am. J. Hum. Genet. 88 (5): 616–20. doi:10.1016/j.ajhg.2011.04.005. PMC 3146735. PMID 21549343.
  9. ^ Wang SK, Aref P, Hu Y, Milkovich RN, Simmer JP, El-Khateeb M, Daggag H, Baqain ZH, Hu JC (Feb 2013). "FAM20A mutations can cause enamel-renal syndrome (ERS)". PLOS Genet. 9 (2): e1003302. doi:10.1371/journal.pgen.1003302. PMC 3585120. PMID 23468644.