BSG (gen)

S Wikipedije, slobodne enciklopedije
(Preusmjereno sa Basigin)
Idi na navigaciju Idi na pretragu
Induktor vanćelijske matrice metaloproteinaze
Protein BSG PDB 3B5H.png
Dostupne strukture
PDBPretraga ortologa: A0A087X2B5 PDBe A0A087X2B5 RCSB
Spisak PDB ID kodova

4U0Q, 3B5H, 3I84, 3I85, 3QQN, 3QR2

Identifikatori
AliasiBSG
Vanjski ID-jeviOMIM: 109480 MGI: 88208 HomoloGene: 1308 GeneCards: BSG
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za Induktor vanćelijske matrice metaloproteinaze
Genomska lokacija za Induktor vanćelijske matrice metaloproteinaze
Bend19p13.3Početak571,277 bp[1]
Kraj583,494 bp[1]
Lokacija gena (miš)
Hromosom 10 (miš)
Hrom.Hromosom 10 (miš)[2]
Hromosom 10 (miš)
Genomska lokacija za Induktor vanćelijske matrice metaloproteinaze
Genomska lokacija za Induktor vanćelijske matrice metaloproteinaze
Bend10 C1|10 39.72 cMPočetak79,540,325 bp[2]
Kraj79,547,803 bp[2]
Obrazac RNK ekspresije
PBB GE BSG 208677 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 protein binding
mannose binding
carbohydrate binding
monocarboxylic acid transmembrane transporter activity
cadherin binding
cell-cell adhesion mediator activity
Ćelijska komponenta integral component of membrane
membrana
focal adhesion
Melanosom
Golđijeva membrana
Ćelijska membrana
integral component of plasma membrane
acrosomal membrane
mitohondrija
Lipidni splav
Sarkolema
Egzosom
intracellular membrane-bounded organelle
Akson
Biološki proces response to peptide hormone
extracellular matrix disassembly
extracellular matrix organization
odontogenesis of dentin-containing tooth
cell surface receptor signaling pathway
decidualization
pyruvate metabolic process
response to mercury ion
response to cAMP
embryo implantation
leukocyte migration
monocarboxylic acid transport
protein localization to plasma membrane
homophilic cell adhesion via plasma membrane adhesion molecules
axon guidance
dendrite self-avoidance
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001728
NM_198589
NM_198590
NM_198591
NM_001322243

NM_001077184
NM_009768

RefSeq (bjelančevina)

NP_001309172
NP_001719
NP_940991
NP_940992
NP_940993

NP_001070652
NP_033898

Lokacija (UCSC)Chr 19: 0.57 – 0.58 MbChr 10: 79.54 – 79.55 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Basigin (BSG), znan i kao induktor vanćelijskog metaloproteinaznog matriksa (EMMPRIN) il i klaster diferencijacije 147 (CD147), je protein koji je kod ljudi kodiran genom BSG.[5][6][7] Ovaj protein je odrednica za OK sistem ljudskih krvnih grupa. U sistemu Ok poznata su tri antigena; najčešći su Oka (također se naziva i OK1), OK2 i OK3. Pokazalo se da je basigin važan receptor na crvenim krvnim zrncima za ljudski parazit malarije, Plasmodium falciparum.[8]

Aminokiselinska sekvanca:

Simboli
1020304050
MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSP
VPEIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVE
EDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFTTVEDLG
SKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGE
YSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPV
TDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYR
CNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRK
PEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS

Funkcija[uredi | uredi izvor]

Basigin je član i superporodice munoglobulina, sa strukturom koja se odnosi na navodni drevni oblik porodice. Kako članovi imunoglobulinske natporodice imaju temeljne uloge u međućelijskom prepoznavanju, uključeni u različite imunske pojave, diferencijaciju i razvoj; smatra se da basigin ima ulogu i u međućelijskom prepoznavanju (Miyauchi et al., 1991; Kanekura et al., 1991).[9][10]

Ima razne funkcije. Uz sposobnost induciranja metaloproteinaze, basigin također regulira nekoliko različitih funkcija, kao što su spermatogeneza, ekspresija monokarboksilatnog transportera i reaktivnost limfocita.[6]

Basigin je tip I integralnih membranskih receptora, koji ima mnogo liganada, uključujući proteine ciklofilin (CyP) Cyp-A i CyP-B i određene integrine.[11][12][13] Eksprimiraju ga mnogi tipovi ćelija, uključujući epitelne, endotelle i leukocite. Ljudski protein basigin sadrži 269 aminokiselina, koje formiraju dva jako glikozilirana tipa C2 imunoglobulinu sličnih domena na N-terminalnom vanćelijskom dijelu. Karakteriziran je i drugi oblik basigina koji sadrži jedan dodatni domen sličan imunoglobulinu u vanćelijskom dijelu.[6]

Interakcije[uredi | uredi izvor]

Pokazano je da masigin ima interakcije sa ubikvitinom C.[14]

Pokazano je da basigin tvori kompleks sa monokarboksilatnim transporterima u mrežnjači miševa. Čini se da je potreban za pravilno postavljanje MCT-a u membranu. U basigin null miševa, neuspjeh MCT-a da se integriraju s membranom može biti izravno povezan s neuspjehom prijenosa hranjivih sastojaka u mrežnjčinom pigmentiranom epitelu (laktati koji se prenose MCT-ovima 1, 3 i 4 ključni su hranjivi sastojci za razvoj RPE) , što je rezultiralo gubitkom vida kod nultih životinja.[15]

Basigin stupa u interakciju sa četvrtim domenom C-tip lektina u receptoru Endo180[16] za formiranje molekulskog epitelno-mezenhimskog prijelaza supresorskog kompleksa, koji ako se poremeti rezultira indukcijom invazivnog ponašanja epitelnih ćelija prostate, povezanog sa lošim preživljavanjem njenog raka.[17]

Uloga u malariji[uredi | uredi izvor]

Nedavno je (novembar 2011.) utvrđeno da je basigin receptor koji je bitan za invaziju većine sojeva Plasmodium falciparum na eritrocite, najvirulentnijih vrsta parazita plazmodija, koji uzrokuju ljudski malariju. Postoje nade da bi se razvojem antitijela na ligand parazita za basigin, Rh5 moglo naći bolje cjepivo za malariju.[8] Na površinu parazita malarije, sasigin se veže proteinom PfRh5 .

Uloga u infekciji SARS-CoV-2 (COVID-19)[uredi | uredi izvor]

Basigin koji se eksprimira u ćeliji domaćinu (CD147) može vezati protein proteina SARS-CoV-2 i možda biti uključen u invaziju ćelija domaćina.[18] Nakon toga, meplazumab, humanizirano antitelo na CD147, testirano je na pacijentima sa upalom pluća u SARS-CoV-2.[19] Neke od ovih tvrdnji osporila je druga grupa naučnika koja nije pronašla dokaze o direktnoj ulozi basigina u vezanju virusnog proteina spike ili promociji infekcije plućnih ćelija.[20]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000172270 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000023175 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Kasinrerk W, Fiebiger E, Stefanová I, Baumruker T, Knapp W, Stockinger H (1992). "Human leukocyte activation antigen M6, a member of the Ig superfamily, is the species homologue of rat OX-47, mouse basigin, and chicken HT7 molecule". J Immunol. 149 (3): 847–54. PMID 1634773.
  6. ^ a b c Yurchenko V, Constant S, Bukrinsky M (2006). "Dealing with the family: CD147 interactions with cyclophilins". Immunology. 117 (3): 301–9. doi:10.1111/j.1365-2567.2005.02316.x. PMC 1782239. PMID 16476049.
  7. ^ Miyauchi T, Masuzawa Y, Muramatsu T (1992). "The basigin group of the immunoglobulin superfamily: complete conservation of a segment in and around transmembrane domains of human and mouse basigin and chicken HT7 antigen". J. Biochem. 110 (5): 770–4. doi:10.1093/oxfordjournals.jbchem.a123657. PMID 1783610.
  8. ^ a b Crosnier C, Bustamante LY, Bartholdson SJ, Bei AK, Theron M, Uchikawa M, Mboup S, Ndir O, Kwiatkowski DP, Duraisingh MT, Rayner JC, Wright GJ (novembar 2011). "Basigin is a receptor essential for erythrocyte invasion by Plasmodium falciparum". Nature. 480 (7378): 534–7. Bibcode:2011Natur.480..534C. doi:10.1038/nature10606. PMC 3245779. PMID 22080952.
  9. ^ "Entrez Gene: BSG basigin (Ok blood group)".
  10. ^ Kanekura T, Chen X, Kanzaki T (2002). "Basigin (CD147) is expressed on melanoma cells and induces tumor cell invasion by stimulating production of matrix metalloproteinases by fibroblasts". Int. J. Cancer. 99 (4): 520–8. doi:10.1002/ijc.10390. PMID 11992541. S2CID 37384660.
  11. ^ Yurchenko V, Zybarth G, O'Connor M, Dai W, Franchin G, Hao T, Guo H, Hung H, Toole B, Gallay P, Sherry B, Bukrinsky M (2002). "Active site residues of cyclophilin A are crucial for its signaling activity via CD147". J Biol Chem. 277 (25): 22959–65. doi:10.1074/jbc.M201593200. PMID 11943775.
  12. ^ Yurchenko V, O'Connor M, Dai W, Guo H, Toole B, Sherry B, Bukrinsky M (2001). "CD147 is a signaling receptor for cyclophilin B". Biochem Biophys Res Commun. 288 (4): 786–8. doi:10.1006/bbrc.2001.5847. PMID 11688976.
  13. ^ Berditchevski F, Chang S, Bodorova J, Hemler M (1997). "Generation of monoclonal antibodies to integrin-associated proteins. Evidence that alpha3beta1 complexes with EMMPRIN/basigin/OX47/M6". J Biol Chem. 272 (46): 29174–80. doi:10.1074/jbc.272.46.29174. PMID 9360995.
  14. ^ Wang WJ, Li QQ, Xu JD, Cao XX, Li HX, Tang F, Chen Q, Yang JM, Xu ZD, Liu XP (2008). "Interaction between CD147 and P-glycoprotein and their regulation by ubiquitination in breast cancer cells". Chemotherapy. 54 (4): 291–301. doi:10.1159/000151225. PMID 18689982. S2CID 7260048.
  15. ^ Philp NJ, Ochrietor JD, Rudoy C, Muramatsu T, Linser PJ (mart 2003). "Loss of MCT1, MCT3, and MCT4 expression in the retinal pigment epithelium and neural retina of the 5A11/basigin-null mouse". Investigative Ophthalmology & Visual Science. 44 (3): 1305–11. doi:10.1167/iovs.02-0552. PMID 12601063.
  16. ^ "WikiGenes: MRC2 - mannose receptor C, type 2 Homo sapiens". Arhivirano s originala, 12. 5. 2021. Pristupljeno 30. 5. 2021.
  17. ^ Rodriguez-Teja M, Gronau JH, Minamidate A, Darby S, Gaughan L, Robson C, Mauri F, Waxman J, Sturge J (mart 2015). "Survival Outcome and EMT Suppression Mediated by a Lectin Domain Interaction of Endo180 and CD147". Molecular Cancer Research (jezik: engleski). American Association for Cancer Research. 13 (3): 538–47. doi:10.1158/1541-7786.MCR-14-0344-T. PMID 25381222.
  18. ^ Wang K, Chen W, Zhang Z, Deng Y, Lian JQ, Du P, et al. (decembar 2020). "CD147-spike protein is a novel route for SARS-CoV-2 infection to host cells". Signal Transduction and Targeted Therapy. 5 (1): 283. doi:10.1038/s41392-020-00426-x. PMC 7714896. PMID 33277466.
  19. ^ Bian H, Zheng ZH, Wei D, Zhang Z, Kang WZ, Hao CQ, et al. (2020). "Meplazumab treats COVID-19 pneumonia: an open-labelled, concurrent controlled add-on clinical trial". bioRxiv. doi:10.1101/2020.03.21.20040691.
  20. ^ Shilts J, Crozier TW, Greenwood EJ, Lehner PJ, Wright GJ (11. 1. 2021). "No evidence for basigin/CD147 as a direct SARS-CoV-2 spike binding receptor". Scientific Reports (jezik: engleski). 11 (1): 413. doi:10.1038/s41598-020-80464-1. ISSN 2045-2322. PMC 7801465. PMID 33432067.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Šablon:Komplementarni sistem