TM9SF2

S Wikipedije, slobodne enciklopedije
TM9SF2
Identifikatori
AliasiTM9SF2
Vanjski ID-jeviOMIM: 604678 MGI: 1915309 HomoloGene: 21004 GeneCards: TM9SF2
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za TM9SF2
Genomska lokacija za TM9SF2
Bend13q32.3Početak99,446,311 bp[1]
Kraj99,564,048 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za TM9SF2
Genomska lokacija za TM9SF2
Bend14 E5|14 65.86 cMPočetak122,344,450 bp[2]
Kraj122,397,016 bp[2]
Obrazac RNK ekspresije
PBB GE TM9SF2 201078 at fs.png
Više referentnih podataka o ekspresiji
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_004800

NM_080556

RefSeq (bjelančevina)

NP_004791

NP_542123

Lokacija (UCSC)Chr 13: 99.45 – 99.56 MbChr 14: 122.34 – 122.4 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Protein 1 porodice TSC22 domena je protein koji je kod ljudi kodiran genom TSC22D1.[5][6]

TSC22 kodira transkripcijski faktor i pripada velikoj porodici geni ranog odgovora. [7] TSC22D1 kodira transkripcijski faktor i pripada velikoj porodici gena za rani odgovor. Putem fluorescentne ibridizacije in situ, Jay et al. (1996) locirali su gen TSC22D1 na hromosomu 13, sekvenca 13q14.[8]

TSC22D1 tvori homodimere, preko konzerviranog domena leucinskog zatvarača i heterodimerizuje s TSC22D4. TSC22D1 ima transkripcijsku represorsku aktivnost.[9]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 1.073 aminokiseline, a molekulska težina 109.677 Da.[10].

1020304050
MHQPPESTAAAAAAADISARKMAHPAMFPRRGSGSGSASALNAAGTGVGS
NATSSEDFPPPSLLQPPPPAASSTSGPQPPPPQSLNLLSQAQLQAQPLAP
GGTQMKKKSGFQITSVTPAQISASISSNNSIAEDTESYDDLDESHTEDLS
SSEILDVSLSRATDLGEPERSSSEETLNNFQEAETPGAVSPNQPHLPQPH
LPHLPQQNVVINGNAHPHHLHHHHQIHHGHHLQHGHHHPSHVAVASASIT
GGPPSSPVSRKLSTTGSSDSITPVAPTSAVSSSGSPASVMTNMRAPSTTG
GIGINSVTGTSTVNNVNITAVGSFNPNVTSSMLGNVNISTSNIPSAAGVS
VGPGVTSGVNVNILSGMGNGTISSSAAVSSVPNAAAGMTGGSVSSQQQQP
TVNTSRFRVVKLDSSSEPFKKGRWTCTEFYEKENAVPATEGVLINKVVET
VKQNPIEVTSERESTSGSSVSSSVSTLSHYTESVGSGEMGAPTVVVQQQQ
QQQQQQQQQPALQGVTLQQMDFGSTGPQSIPAVSIPQSISQSQISQVQLQ
SQELSYQQKQGLQPVPLQATMSAATGIQPSPVNVVGVTSALGQQPSISSL
AQPQLPYSQAAPPVQTPLPGAPPPQQLQYGQQQPMVSTQMAPGHVKSVTQ
NPASEYVQQQPILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTA
VPAQPAGASVQPVGQAPAAVSAVPTGSQIANIGQQANIPTAVQQPSTQVP
PSVIQQGAPPSSQVVPPAQTGIIHQGVQTSAPSLPQQLVIASQSSLLTVP
PQPQGVEPVAQGIVSQQLPAVSSLPSASSISVTSQVSSTGPSGMPSAPTN
LVPPQNIAQTPATQNGNLVQSVSQPPLIATNTNLPLAQQIPLSSTQFSAQ
SLAQAIGSQIEDARRAAEPSLVGLPQTISGDSGGMSAVSDGSSSSLAASA
SLFPLKVLPLTTPLVDGEDESSSGASVVAIDNKIEQAMDLVKSHLMYAVR
EEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPA
TTQPQGTTQPPAQPASQGSGPTA
Simboli

Kloniranje i ekspresija[uredi | uredi izvor]

Skriningom male količine klonova u biblioteci cDNK, od 6-sedmičnih mišjih embriona, Jay et al. (1996) klonirali su TSC22D1, koji su nazvali TSC22. Izvedeni protein sa 144 aminokiseline imao je izračunatu molekulsku masu od oko 16,7 kD i leucinski zatvarač, C-kraj bogat glutaminom i prolinom i dva potencijalna mjesta fosforilacije. TSC22 dijeli značajnu homolog[iju sa Tsc22 kod miševa, pacova i kokoši, a 69% identiteta sa svinjskim Dsipom i 52% identiteta sa proteinom za kratkovidnost kod Drosophila. Zoo blot analiza otkrila je srodne sekvence kod svih zastupljenih kičmenjaka i voćnih mušica. Signal nije otkriven u dagnjama, nematodama, kvascima i bakterijama.

Prema Southwestern scriningu, Ohta et al. (1996) identificirali su pacovaa Tsc22 vezanjem za GC-bogati element promotora CNP. Koristili su ovu sekvencu za oblikovanje prajmera i kloniranja ljudskog TSC22, pomoću PCR-a i 3' i 5' RACE biblioteke cDNK fetusnog bubrega. Ljudski TSC22 razlikuje se od proteina pacova po inserciji jednog ostatka i jednoj zamjeni. Proteini pacova i miša su identični.

Prema Northern blot analizi, Jay et al (1996) i Ohta et al. (1996) utvrdili su da je TSC22 eksprimiran kao 1,8 kb transkript u različitim količinama u svim tkivima fetusa i odraslih, osim leukocita periferne krvi. Transkript od oko pet kb također je otkriven u skeletnim mišićima.[11]

Funkcija gena[uredi | uredi izvor]

Analizom pomaka mobilnosti i kotransfekcijom s reporter-plazmidom, Ohta et al. (1996) potvrdili su da se pacovski Tsc22 veže i može podstaknuti ekspresiju iz sekvence CNP promotora, bogate GC-om. U endotelnim ćelijama ljudske aorte ekspresiju TSC22 stimulirali su citokini, uključujući TGFB, i brzo se izgubila. Ekspresija TSC22 iRNK korelira sa povećanim nivoom CNP iRNK.

Analizom 2-hibrida kvasca, ispitivanjem pomaka gela i eksperimentima povlačenja GST-a, Kester et al. (1999) potvrdili su da TSC22D1 formira homodimere, preko konzerviranog domena leucinskog zatvarača i da stupa u interakciju s TSC22D4, formiranjem heterodimera. Pokazali su da TSC22D1 ima transkripcijsku represorsku aktivnost.[12]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000125304 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000025544 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Jay P, Ji JW, Marsollier C, Taviaux S, Berge-Lefranc JL, Berta P (Jul 1996). "Cloning of the human homologue of the TGF beta-stimulated clone 22 gene". Biochem Biophys Res Commun. 222 (3): 821–6. doi:10.1006/bbrc.1996.0825. PMID 8651929.
  6. ^ Ohta S, Shimekake Y, Nagata K (Mar 1997). "Molecular cloning and characterization of a transcription factor for the C-type natriuretic peptide gene promoter". Eur J Biochem. 242 (3): 460–6. doi:10.1111/j.1432-1033.1996.460rr.x. PMID 9022669.
  7. ^ "Entrez Gene: TSC22D1 TSC22 domain family, member 1".
  8. ^ Jay, P., Ji, J. W., Marsollier, C., Taviaux, S., Berge-Lefranc, J.-L., Berta, P. Cloning of the human homologue of the TGF-beta-stimulated clone 22 gene. Biochem. Biophys. Res. Commun. 222: 821-826, 1996. PubMed: 8651929
  9. ^ Kester HA, Blanchetot C, den Hertog J, van der Saag PT, van der Burg B (September 1999). "Transforming growth factor-beta-stimulated clone-22 is a member of a family of leucine zipper proteins that can homo- and heterodimerize and has transcriptional repressor activity". J. Biol. Chem. 274 (39): 27439–47. doi:10.1074/jbc.274.39.27439. PMID 10488076.
  10. ^ "UniProt, Q15714". Pristupljeno 2021-08-06. CS1 održavanje: nepreporučeni parametar (link)
  11. ^ Ohta, S., Shimekake, Y., Nagata, K. Molecular cloning and characterization of a transcription factor for the C-type natriuretic peptide gene promoter. Europ. J. Biochem. 242: 460-466, 1996. PubMed: 9022669
  12. ^ Kester, H. A., Blanchetot, C., den Hertog, J., van der Saag, P. T., van der Burg, B. Transforming growth factor-beta-stimulated clone-22 is a member of a family of leucine zipper proteins that can homo- and heterodimerize and has transcriptional repressor activity. J. Biol. Chem. 274: 27439-27447, 1999. PubMed: 10488076

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]