XPO4

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
XPO4
Identifikatori
AliasiXPO4
Vanjski ID-jeviOMIM: 611449 MGI: 1888526 HomoloGene: 10733 GeneCards: XPO4
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za XPO4
Genomska lokacija za XPO4
Bend13q12.11Početak20,777,329 bp[1]
Kraj20,903,048 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za XPO4
Genomska lokacija za XPO4
Bend14|14 C3Početak57,577,521 bp[2]
Kraj57,665,430 bp[2]
Obrazac RNK ekspresije
PBB GE XPO4 218479 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija nuclear export signal receptor activity
GO:0001948, GO:0016582 protein binding
Ćelijska komponenta Jedrova pora
Jedro
Nukleoplazma
citoplazma
citosol
Biološki proces positive regulation of protein export from nucleus
protein transport
nuclear export
protein export from nucleus
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_022459
NM_001372061

NM_020506

RefSeq (bjelančevina)

NP_071904
NP_001358990

NP_065252
NP_001355626
NP_001355627

Lokacija (UCSC)Chr 13: 20.78 – 20.9 MbChr 14: 57.58 – 57.67 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Eksportin-4 je protein koji je kod ljudi kodiran genom XPO4. Citogenetička lokacija ovog gena je na hromosomu 13, sekvenca: 13q12.11, a genomske koordinte (GRCh38): 13:20,777.328 – 20,902.773 bp (prema NCBI).

XPO4 pripada velikoj porodici karioferina, koji posreduju u transportu proteina i drugog tereta između jedarnog i citoplazmatskog odjeljka (Lipowsky et al., 2000).[5][6][7][8]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 1.154 aminokiseline, a molekulska težina 130.139 Da.[9].

1020304050
MMAAALGPPEVIAQLENAAKVLMAPPSMVNNEQRQHAEHIFLSFRKSKSP
FAVCKHILETSKVDYVLFQAATAIMEAVVREWILLEKGSIESLRTFLLTY
VLQRPNLQKYVREQILLAVAVIVKRGSLDKSIDCKSIFHEVSQLISSGNP
TVQTLACSILTALLSEFSSSSKTSNIGLSMEFHGNCKRVFQEEDLRQIFM
LTVEVLQEFSRRENLNAQMSSVFQRYLALANQVLSWNFLPPNLGRHYIAM
FESSQNVLLKPTESWRETLLDSRVMELFFTVHRKIREDSDMAQDSLQCLA
QLASLHGPIFPDEGSQVDYLAHFIEGLLNTINGIEIEDSEAVGISSIISN
LITVFPRNVLTAIPSELFSSFVNCLTHLTCSFGRSAALEEVLDKDDMVYM
EAYDKLLESWLTLVQDDKHFHKGFFTQHAVQVFNSYIQCHLAAPDGTRNL
TANGVASREEEEISELQEDDRDQFSDQLASVGMLGRIAAEHCIPLLTSLL
EERVTRLHGQLQRHQQQLLASPGSSTVDNKMLDDLYEDIHWLILVTGYLL
ADDTQGETPLIPPEIMEYSIKHSSEVDINTTLQILGSPGEKASSIPGYNR
TDSVIRLLSAILRVSEVESRAIRADLTHLLSPQMGKDIVWFLKRWAKTYL
LVDEKLYDQISLPFSTAFGADTEGSQWIIGYLLQKVISNLSVWSSEQDLA
NDTVQLLVTLVERRERANLVIQCENWWNLAKQFASRSPPLNFLSSPVQRT
LMKALVLGGFAHMDTETKQQYWTEVLQPLQQRFLRVINQENFQQMCQQEE
VKQEITATLEALCGIAEATQIDNVAILFNFLMDFLTNCIGLMEVYKNTPE
TVNLIIEVFVEVAHKQICYLGESKAMNLYEACLTLLQVYSKNNLGRQRID
VTAEEEQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQAANRSVS
AADVVLYGVNLILPLMSQDLLKFPTLCNQYYKLITFICEIFPEKIPQLPE
DLFKSLMYSLELGMTSMSSEVCQLCLEALTPLAEQCAKAQETDSPLFLAT
RHFLKLVFDMLVLQKHNTEMTTAAGEAFYTLVCLHQAEYSELVETLLSSQ
QDPVIYQRLADAFNKLTASSTPPTLDRKQKMAFLKSLEEFMANVGGLLCV
K
Simboli

Kloniranje i ekspresija[uredi | uredi izvor]

Sekvenciranjem klonova dobijenih iz cDNK biblioteke hipokampusa frakcionirane veličine odraslih, Nagase et al. (2000) klonirali XPO4, koji su označili kao KIAA1721. 3' UTR sadrži ponavljajuću sekvencu, a protein od 1.150 aminokiselina dijeli 99% identiteta aminokiselina s mišjim Xpo4. RT-PCR ELISA testom otkrili su visoku do umjerenu ekspresiju u svim ljudskim tkivima i određenim regijama mozga.[10]

Korištenje afinitetne hromatografije na imobiliziranom RanGTP-u, za identifikaciju novih proteina koji vežu RanGTP u ekstraktu ćelije HeLa, nakon čega slijedi analiza baze podataka i 3' i 5' RACE, Lipowsky et al. (2000) klonirali mišji Xpo4, koji su nazvali Exp4. Izvedeni mišji protein od 1.170 aminokiselina ima izračunatu molekulsku masu od 129,9 kD. Xpo4 ima sličnost u odnosu na motiv vezivanja za N-terminalni RanGTP sa članovima porodice importin-beta, sa najvećom sličnošću sa eksportinom-1 (XPO1) i eksportnim receptorom tRNK exportina-t (XPOT).

Funkcija gena[uredi | uredi izvor]

Korištenjem rekombinantnog Xpo4 eksprimiranog u komponentama ćelije E. coli i ćelija HeLa, Lipowsky et al. (2000) pokazali su da je vezan za RanGTP Xpo4, odnosno EIF5A i timidilat sintazu (TYMS). Imunobloting test rekombinantnog EIF5A i vezanog Xpo4 pokazao je da EIF5A specifično formira kompleks EIF5A-Xpo4-RanGTP sa Xpo4 i da je interakcija Xpo4-EIF5A poboljšana u prisustvu RanGTP. Analize jedarnog ekspotra u permeabiliziranim ćelijama pokazale su da Xpo4 posreduje u specifičnom jedarnom eksportu EIF5A. Analizom mutacija i posttranslacijskih modifikacija, zaključili su da je interakcija Xpo4-EIF5A složena i zahtijeva velike dijelove molekula EIF5A i hipusinsku modifikaciju EIF5A.[11]

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000132953 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000021952 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Lipowsky, G., Bischoff, F. R., Schwarzmaier, P., Kraft, R., Kostka, S., Hartmann, E., Kutay, U., Gorlich, D. Exportin 4: a mediator of a novel nuclear export pathway in higher eukaryotes. EMBO J. 19: 4362-4371, 2000. PubMed: 10944119
  6. ^ Nagase T, Kikuno R, Hattori A, Kondo Y, Okumura K, Ohara O (Feb 2001). "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro". DNA Res. 7 (6): 347–55. doi:10.1093/dnares/7.6.347. PMID 11214970.
  7. ^ Lipowsky G, Bischoff FR, Schwarzmaier P, Kraft R, Kostka S, Hartmann E, Kutay U, Gorlich D (Sep 2000). "Exportin 4: a mediator of a novel nuclear export pathway in higher eukaryotes". EMBO J. 19 (16): 4362–71. doi:10.1093/emboj/19.16.4362. PMC 302028. PMID 10944119.
  8. ^ "Entrez Gene: XPO4 exportin 4".
  9. ^ "UniProt, Q9C0E2". Pristupljeno 2021-08-05. CS1 održavanje: nepreporučeni parametar (link)
  10. ^ Nagase, T., Kikuno, R., Hattori, A., Kondo, Y., Okumura, K., Ohara, O. Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 7: 347-355, 2000. PubMed: 11214970
  11. ^ Kurisaki, A., Kurisaki, K., Kowanetz, M., Sugino, H., Yoneda, Y., Heldin, C.-H., Moustakas, A. The mechanism of nuclear export of Smad3 involves exportin 4 and Ran. Molec. Cell. Biol. 26: 1318-1332, 2006. PubMed: 16449645

Dopunska literatura[uredi | uredi izvor]