ACAD10

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
ACAD10
Identifikatori
AliasiACAD10
Vanjski ID-jeviOMIM: 611181 MGI: 1919235 HomoloGene: 49825 GeneCards: ACAD10
Lokacija gena (čovjek)
Hromosom 12 (čovjek)
Hrom.Hromosom 12 (čovjek)[1]
Hromosom 12 (čovjek)
Genomska lokacija za ACAD10
Genomska lokacija za ACAD10
Bend12q24.12Početak111,686,053 bp[1]
Kraj111,757,107 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za ACAD10
Genomska lokacija za ACAD10
Bend5|5 FPočetak121,759,089 bp[2]
Kraj121,798,577 bp[2]
Ontologija gena
Molekularna funkcija oxidoreductase activity, acting on the CH-CH group of donors
oxidoreductase activity
hydrolase activity
acyl-CoA dehydrogenase activity
flavin adenine dinucleotide binding
Ćelijska komponenta mitochondrial matrix
mitohondrija
Biološki proces fatty acid beta-oxidation
metabolizam
fatty acid beta-oxidation using acyl-CoA dehydrogenase
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_025247
NM_001136538
NM_001136542

NM_028037

RefSeq (bjelančevina)

NP_001130010
NP_079523

NP_082313

Lokacija (UCSC)Chr 12: 111.69 – 111.76 MbChr 5: 121.76 – 121.8 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Član 10 porodice acil-CoA dehidrogenaza je protein koji je kod ljudi kodiran genom ACAD10.[5]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 1.059 aminokiselina, a molekulska težina 118.834 Da.[6]

1020304050
MCVRSCFQSPRLQWVWRTAFLKHTQRRHQGSHRWTHLGGSTYRAVIFDMG
GVLIPSPGRVAAEWEVQNRIPSGTILKALMEGGENGPWMRFMRAEITAEG
FLREFGRLCSEMLKTSVPVDSFFSLLTSERVAKQFPVMTEAITQIRAKGL
QTAVLSNNFYLPNQKSFLPLDRKQFDVIVESCMEGICKPDPRIYKLCLEQ
LGLQPSESIFLDDLGTNLKEAARLGIHTIKVNDPETAVKELEALLGFTLR
VGVPNTRPVKKTMEIPKDSLQKYLKDLLGIQTTGPLELLQFDHGQSNPTY
YIRLANRDLVLRKKPPGTLLPSAHAIEREFRIMKALANAGVPVPNVLDLC
EDSSVIGTPFYVMEYCPGLIYKDPSLPGLEPSHRRAIYTAMNTVLCKIHS
VDLQAVGLEDYGKQGDYIPRQVRTWVKQYRASETSTIPAMERLIEWLPLH
LPRQQRTTVVHGDFRLDNLVFHPEEPEVLAVLDWELSTLGDPLADVAYSC
LAHYLPSSFPVLRGINDCDLTQLGIPAAEEYFRMYCLQMGLPPTENWNFY
MAFSFFRVAAILQGVYKRSLTGQASSTYAEQTGKLTEFVSNLAWDFAVKE
GFRVFKEMPFTNPLTRSYHTWARPQSQWCPTGSRSYSSVPEASPAHTSRG
GLVISPESLSPPVRELYHRLKHFMEQRVYPAEPELQSHQASAARWSPSPL
IEDLKEKAKAEGLWNLFLPLEADPEKKYGAGLTNVEYAHLCELMGTSLYA
PEVCNCSAPDTGNMELLVRYGTEAQKARWLIPLLEGKARSCFAMTEPQVA
SSDATNIEASIREEDSFYVINGHKWWITGILDPRCQLCVFMGKTDPHAPR
HRQQSVLLVPMDTPGIKIIRPLTVYGLEDAPGGHGEVRFEHVRVPKENMV
LGPGRGFEIAQGRLGPGRIHHCMRLIGFSERALALMKARVKSRLAFGKPL
VEQGTVLADIAQSRVEIEQARLLVLRAAHLMDLAGNKAAALDIAMIKMVA
PSMASRVIDRAIQAFGAAGLSSDYPLAQFFTWARALRFADGPDEVHRATV
AKLELKHRI

Struktura[uredi | uredi izvor]

Ovaj gen kodira člana porodice enzima acyl-CoA dehidrogenaze (ACAD), koji učestvuju u beta-oksidaciji masnih kiselina u mitohondrijama. Kodirani enzim sadrži domen hidrolaze na N-terminalnom dijelu, katalitski domen serin/treonin protein-kinaze u centralnoj regiji i konzervirani ACAD domen na C-kraju. Opisano je nekoliko alternativno prerađenih varijanti transkripta ovog gena, ali priroda nekih od ovih varijanti nije utvrđena cijelom dužinom.[5]

Klinički značaj[uredi | uredi izvor]

U narodu Pima, ACAD10 je identifikovan kao gen povezan sa dijabetesom tipa 2, insulinskom rezistencijom i poremećenim metabolizmom lipida. Konkretno, dva jednonukleotidna polimorfizma, rs601663 i rs659964, značajno su povezana s ovim simptomima u velikoj populaciji ljudi Pima i ostalim autohtonim narodima Amerike.[7]

Interakcije[uredi | uredi izvor]

Korištenjem masene spektrometrije za procjenu afiniteta, zaključuje se interakcija kada je proteinska sond afinitetodređuje iz ekstrakata ćelija poliklonskim antitijelima ili epitopskom oznakom, a pridruženi partner za interakciju je identificiran metodama masene spektrometrije. Pomoću ovog metoda pokazalo se da ACAD10 stupa u interakciju s P2RY8, NDUFA10, NTRK3, SLC2A12, LPAR4, PTH1R, COLEC10 , APP, MAS1, CD79A, BSG i Ubikvitin C.[8]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000111271 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000029456 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b "Entrez Gene: Acyl-CoA dehydrogenase family, member 10".
  6. ^ "UniProt, Q6JQN1". Pristupljeno 2021-08-06. CS1 održavanje: nepreporučeni parametar (link)
  7. ^ Bian L, Hanson RL, Muller YL, Ma L, Kobes S, Knowler WC, Bogardus C, Baier LJ (Jul 2010). "Variants in ACAD10 are associated with type 2 diabetes, insulin resistance and lipid oxidation in Pima Indians". Diabetologia. 53 (7): 1349–53. doi:10.1007/s00125-010-1695-y. PMC 2947857. PMID 20390405.
  8. ^ "ACAD10 Results Summary". BioGrid. TheTyerslab.com. Pristupljeno 18 May 2015. CS1 održavanje: nepreporučeni parametar (link)

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]