CCDC47

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
CCDC47
Identifikatori
AliasiCCDC47
Vanjski ID-jeviOMIM: 618260 MGI: 1914413 HomoloGene: 41351 GeneCards: CCDC47
Lokacija gena (čovjek)
Hromosom 17 (čovjek)
Hrom.Hromosom 17 (čovjek)[1]
Hromosom 17 (čovjek)
Genomska lokacija za CCDC47
Genomska lokacija za CCDC47
Bend17q23.3Početak63,745,255 bp[1]
Kraj63,776,351 bp[1]
Ontologija gena
Molekularna funkcija calcium ion binding
GO:0001948 protein binding
RNA binding
Ćelijska komponenta integral component of membrane
rough endoplasmic reticulum
membrana
Endoplazmatski retikulum
Biološki proces post-embryonic development
calcium ion homeostasis
osteoblast differentiation
endoplasmic reticulum organization
ubiquitin-dependent ERAD pathway
ER overload response
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_020198

NM_026009

RefSeq (bjelančevina)

NP_064583

NP_080285

Lokacija (UCSC)Chr 17: 63.75 – 63.78 Mbn/a
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Pozicija gena CCDC47 na ljudskom hromosomu 17

Domen upredene zavojnice 47 (CCDC47) je gen na hromosomu 17, lokus 17q23.3 koji kodira protein CCDC47. Gen ima nekoliko alijasa, uključujući GK001 i MSTP041. Sam protein sadrži domene sa upredenom zavojnicom, superporodice SEEEED, domen nepoznate funkcije (DUF1682) i transmembranski domen. Funkcija proteina je nepoznata, ali predloženo je da je CCDC47 uključen u homeostazu iona kalcija i odgovor na preopterećenje endoplazmatskog retikuluma.[4]

Gen[uredi | uredi izvor]

Sam gen CCDC47 nalazi se na minus lancu ljudskog hromosoma 17 i sadrži 13 egzonskih mjesta prerade i 14 različitih introna. Nakon uklanjanja egzona, gen je dugačak 3.445 baznih parova. Nisu pronađeni dokazi za mikro RNK ili pseudogenima .Gen nema razne izoforme, postoji samo varijanta transkripta 1X. [[slika:Chromosome 17 Diagram.jpg|thumb|400px|left|Genske lokacije CCDC47 na

Protein[uredi | uredi izvor]

Struktura[uredi | uredi izvor]

Dužina polipeptidnog lanca je 483 aminokiseline, sa molekulskom težinom od 55.874,[5].

Aminokiselinska sekvenca

1020304050
MKAFHTFCVVLLVFGSVSEAKFDDFEDEEDIVEYDDNDFAEFEDVMEDSV
TESPQRVIITEDDEDETTVELEGQDENQEGDFEDADTQEGDTESEPYDDE
EFEGYEDKPDTSSSKNKDPITIVDVPAHLQNSWESYYLEILMVTGLLAYI
MNYIIGKNKNSRLAQAWFNTHRELLESNFTLVGDDGTNKEATSTGKLNQE
NEHIYNLWCSGRVCCEGMLIQLRFLKRQDLLNVLARMMRPVSDQVQIKVT
MNDEDMDTYVFAVGTRKALVRLQKEMQDLSEFCSDKPKSGAKYGLPDSLA
ILSEMGEVTDGMMDTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPL
KLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNR
EGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDP
EKQRRLEEAALRREQKKLEKKQMKMKQIKVKAM
Simboli

Protein kiji je kodiran CCDC47-om ima dužinu od 483 aminokiseline i sadrži signalni peptid i transmembranski domen. Bogat je negativno nabijenim aminokiselinama, kao što su asparaginska i glutaminska kiselina, dajući mu kiselu izoelektričnu tačku od 4,56.[6] Protein je također bogat metioninom. Ukupno je težak 55,9 kDa, što se konzervira kroz razne ortologe. CCDC47 također sadrži SEEEED superporodicu i domen nepoznate funkcije 1682 (DUF1682). Superporodica SEEEED je kratko, malo složeno područje, koje se uglavnom sastoji od serina. Porodica rutinski leži na kompleksu klatrinskog adaptera 3 proteinske beta-1 podjedinice.[7] Tačna funkcija DUF 1682 nije jasna, ali jedan član porodice opisan je kao protein specifičan za adipocite.[8] [[slika:C Terminus CCDC47.png|thumb|Progrtam PHYRE je sa 76,1% pouzdanosti mogao predvidjeti strukturu C-kraja CCDC47 iz aminokiselina 396-473. Ova alfa-heliks na struktura je prikazana gore.]]

U strukturi CCDC47, postoje dvije predviđene disulfidne veze, kod cisteina 209 do 214 i cisteina 215 do 283.[9] C-terminalni dio proteina je visoko nabijen i predviđa se da je njegova sekundarna struktura regija alfa-heliksnog područja.[10] Ovo područje također sadrži domene upredenih zavojnica, koji su strukturni motivi u kojima se zajedno savijaju 2-7 alfa-heliksi i potom uključuju u biološku ekspresiju. Ovi domeni obično slijede obrazac HxxHCxC, gdje je H hidrofobna aminokiselina, C je nabijena aminokiselina, a x je bilo koja aminokiselina.[11] Mnoge aminokiselinskr sekvence koje slijede ovaj obrazac vide se u C-terminalnom području CCDC47, gdje je zastupljeno najveće konzerviranje putem ortologa.

Konstrukt proteina CCDC47, uključujuči signalne peptide, superporodicu SEEEED, transmembranski domen i DUF1682.

Regulacijai translacija[uredi | uredi izvor]

CCDC47 je reguliran promotor GXP43413.[12] Promotor je dug 819 baznih parova i izuzetno je konzerviran kod sisara. Konzervirana mjesta vezanja kod sisara koja se nalaze na ovom promotoru uključuju jedarnini respiratorni faktor 1 (NFR1), cAMP-reagujući element koji veže element (CREB), PAR b ZIP porodicu i Sp4 transkripcijski faktor. NRF1 kodira protein homodimerizacije i aktiviranja ekspresije ključnih metaboličkih gena. CREB se veže na elemente odgovora na cAMP, povećavajući ili smanjujući transkripciju gena nizvodno[13] dok je porodica PAR b ZIP uključena u regulaciju cirkadijskih ritmova.[14]

Što se tiče iRNK, transkacija počinje u baznom paru 337 i završava sa 1728. Postoji snažna matična petlja koja se nalazi u 5 'UTR regionu, od baza 289-318, koji je vjerovatno uključen u regulaciju iRNK, zbog njegove neposredne blizine startnom kodonu.[15]

Ćelijska distribucija[uredi | uredi izvor]

Smatra se da se konačni protein prenosi iz endoplazmatskog retikuluma (ER) u ćelijsku citoplazmu. Protein je usidren u membrani ER na transmembranskom domenu koji se nalazi od aminokiseline 137 do 165.[16] Predviđa se da je dio proteina koji se proteže u citosol vrlo fosforiliran, jer su mjesta fosforilacije proteina konzrvirana u ortolozima košljoriba.[17] Istraživanje je pokazalo da se CCDC47 eksprimira u odgovoru na preopterećenje ER, što čini ovu blizinu ER važnom.[18]

Posttranslacijska modifikacija[uredi | uredi izvor]

Pored visokog nivoa fosforilacija viđenog u CCDC47, predviđaju se i konzerviraju tri mjesta za sulfiniranje kod sisara, gmizavaca i ptica, ali ne i kod riba, vodozemaca i beskičmenjaka.[19] Također se uočava et potencijalnih mjesta sumoilacija i konzervira u prošlost, sve do košljoriba.[20] Ne postoji glikozilacija proteina jer se ne predviđa da će se proširiti u vanćelijski dio ćelije.

Ekspresija[uredi | uredi izvor]

Obrasci mikromreža ekspresije tkiva iz GEO analizirani su i pokazali su da se čini da je CCDC47 sveprisutno izražen u umjerenim nivoima u mnogim različitim ljudskim tkivima.[21] Iako je protein sveprisutan, najveći nivo ekspresije zabilježen je u neuronskim tkivima kao što su gornja cerviksna ganglija, moždana amigdala i cilijarna ganglija. Povišena ekspresija se takođe vidi u štitnjači i CD34 + ćelijama.

Homologija[uredi | uredi izvor]

CCDC47 nema poznate paraloge putem tekstualnih upita, BLAST i BLAT. Gen ima mnogo ortologa, koji se protežu natrag do beskičmenjaka kao što je C. elegans i vrlo je konzerviran kod sisara sa procentom identiteta većim od 95%. CCDC47 sekvenciran je u širokoj taksonomiji organizama, uključujući sisare, ptice, gmizavce, vodozemce, košljoribe i beskičmenjake. Procenat identiteta ljudskog CCDC47 određenom ortologu opada sa porastom godina divergencije, kako se očekivalo. Homologni geni CCDC47 također su prisutni kod komarca, gljiva, arabidopsa i azijskoe riže. Ovi homolozi sadrže isti DUF1682 koji se nalazi u CCDC47. Ne postoji glikozilacija proteina jer se ne predviđa da će se proširiti u vanćelijski dio ćelije.

Ortokozi CCDC47
Rod

Vrsta

Uobičajeno ime organizma Divergencija od ljudi

(milioni godina)[22]

Pristuoni broj proteina u NCBI Identitet sekvence prema ljudskoj [23] Dužina sekvence

(AA)

Mus musculus Miš 92,3 NP_080285.2 97,90% 483
Myotis davidii Mišouhi šišmiš 94,2 XP_006776781.1 97,50% 483
Elephantulus edwardii Slonovska rovka 98,7 XP_006886355.1 95,00% 483
Alligator mississippiensis Američki aligator 296 XP_006271625.1 91,00% 482
Falco cherrug Stepski soko 296 XP_005439470.1 90,10% 482
Ophiophagus hannah Kraljevska kobra 296 ETE73955 78,90% 516
Xenopus laevis Afrička kandžasta žaba 3712 NP_001087058.1 78,70% 489
Danio rerio Zebrica 400,1 NP_001004551.1 76,20% 486
Latimeria chalumnae Latimerija 414,9 XP_00599466.3 83,50% 478
Saccoglossus kowalevskii Žirnjak 661,2 XP_006822108 50,50% 496
Pediculus humanus corporis Uholadža 782,7 XP_002424359 46,10% 447
Acyrthosiphon pison Biljna uš 782,7 NP_001162147 43,50% 449
Caenorhabditis elegans Obla glista 937,5 NP_497788.1 35,10% 442

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000108588 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "AceView". NCBI. Pristupljeno 1. 3. 2014.[trajno mrtav link]
  5. ^ "UniProt, Q96A33". Pristupljeno 12. 9. 2017.
  6. ^ "SAPS Anaysis". SDSC Workbench. Pristupljeno 14. 4. 2014.
  7. ^ "NCBI BLAST". National Center for Biotechnology Information. Pristupljeno 7. 3. 2014.[trajno mrtav link]
  8. ^ "Genecards". The Human Gene Compendium. Pristupljeno 7. 3. 2014.
  9. ^ "Sulfinator". ExPASy. Pristupljeno 7. 4. 2014.
  10. ^ "PHYRE 2 Protein Recognition Software". Pristupljeno 14. 4. 2014.
  11. ^ Mason JM, Arndt KM (2004). "Coiled coil domains: stability, specificity, and biological implications". ChemBioChem. 5 (2): 170–6. doi:10.1002/cbic.200300781. PMID 14760737. S2CID 39252601.
  12. ^ "El Dorado". Genomatix. Pristupljeno 3. 4. 2014.[trajno mrtav link]
  13. ^ "Protein One". Transcription Factors. Arhivirano s originala, 5. 6. 2014. Pristupljeno 29. 3. 2014.
  14. ^ "Protein Spotlight, The PAR b ZIP Family". Pristupljeno 28. 3. 2014.
  15. ^ "The mfold Web Server". Pristupljeno 3. 4. 2014.
  16. ^ "DAS-TM Filter Server". ExPASy. Arhivirano s originala, 5. 2. 2018. Pristupljeno 17. 4. 2014.
  17. ^ "NetPhos Server 2.0". ExPASy. Pristupljeno 20. 4. 2014.
  18. ^ Viguerie, Nathalie; Picard, Flora; Hul, Gabby; Roussel, Balbine; Barbe, Pierre; Iacovoni, Jason S.; Valle, Carine; Langin, Dominique; Saris, Wim H. M. (2012). "Multiple effects of a short-term dexamethasone treatment in human skeletal muscle and adipose tissue". Physiological Genomics. 44 (2): 141–151. doi:10.1152/physiolgenomics.00032.2011. ISSN 1094-8341. PMID 22108209.
  19. ^ "Sulfinator". ExPASy. Pristupljeno 20. 4. 2014.
  20. ^ "SumoPLOT". ExPASy. Pristupljeno 20. 4. 2014.[trajno mrtav link]
  21. ^ [https: // www.ncbi.nlm.nih.gov/geo "GEO Profiles"] Provjerite vrijednost parametra |url= (pomoć). NCBI. Pristupljeno 20. mart 2014.
  22. ^ "Time Tree: The Timescale of Life". Pristupljeno 13. 3. 2014.
  23. ^ "BLAST". NCBI. Pristupljeno 13. 3. 2014.

Vanjski linkovi[uredi | uredi izvor]