GTPBP3

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
GTPBP3
Identifikatori
AliasiGTPBP3
Vanjski ID-jeviOMIM: 608536 MGI: 1917609 HomoloGene: 6600 GeneCards: GTPBP3
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za GTPBP3
Genomska lokacija za GTPBP3
Bend19p13.11Početak17,334,920 bp[1]
Kraj17,342,731 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za GTPBP3
Genomska lokacija za GTPBP3
Bend8|8 B3.3Početak71,488,103 bp[2]
Kraj71,499,583 bp[2]
Obrazac RNK ekspresije
PBB GE GTPBP3 213835 x at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija nucleotide binding
GO:0001948 protein binding
GO:0006184 GTPase activity
GTP binding
Ćelijska komponenta intracellular anatomical structure
Jedro
mitohondrija
citoplazma
Biološki proces tRNA modification
tRNA processing
tRNA wobble uridine modification
tRNA methylation
embryonic organ development
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_133644
NM_001128855
NM_001195422
NM_032620

NM_032544

RefSeq (bjelančevina)

NP_001122327
NP_001182351
NP_116009
NP_598399

NP_115933

Lokacija (UCSC)Chr 19: 17.33 – 17.34 MbChr 8: 71.49 – 71.5 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Modifikacija mitohondrijske tRNK GTPaze GTPBP3 je enzim koji je kod ljudi kodiran genom GTPBP3 sa hromosoma 19.[5][6]

Gen GTPBP3 kodira GTP – protein koji veže i koji je evolucijski knzerviran od bakterija do sisara [7] a koji je lokaliziran na mitohondrijama i funkcionira u modifikaciji tRNK.[6] Poznate su najmanje dvije glavne izoforme zbog alternativne prerade, Pored toga, poznat je polimorfizam na valinu 250 i može uticati na gluhoću izazvanu aminoglidozidom.[6]

Struktura[uredi | uredi izvor]

Gen GTPBP3 sadrži 10 egzona,[6] i kodira ~ 44 kDa GTP - vezivnog proteina koji je evolucijski konzrerviran, od bakterija do sisara.[7] N-terminalni domen mitohondrijske tRNK modifikacije GTPaze posreduje u dimerizaciji proteina na način neovisan o kaliju,[6] u kodira ~44 kDa GTP-vezujući protein, koji je evolucijsski konzerviran, od bakterija do sisara.[7] N-terminal]]ni domen mitohondrijske tRNK modifikacije GTPaze posreduje u dimerizaciji proteina na način neovisan o kaliju,[8] za koje se smatra da su povezane s izgradnjom mjesta vezanja za donora s jednim ugljikom u njegovoj reakcijskoj funkciji tRNK.[8]

Aminokiselinska sekvenca
1020304050
MWRGLWTLAAQAARGPRRLCTRRSSGAPAPGSGATIFALSSGQGRCGIAV
IRTSGPASGHALRILTAPRDLPLARHASLRLLSDPRSGEPLDRALVLWFP
GPQSFTGEDCVEFHVHGGPAVVSGVLQALGSVPGLRPAEAGEFTRRAFAN
GKLNLTEVEGLADLIHAETEAQRRQALRQLDGELGHLCRGWAETLTKALA
HVEAYIDFGEDDNLEEGVLEQADIEVRALQVALGAHLRDARRGQRLRSGV
HVVVTGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLETPVDLAGFPVL
LSDTAGLREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFL
ATVVASVGAQSPSDSSQRLLLVLNKSDLLSPEGPGPGPDLPPHLLLSCLT
GEGLDGLLEALRKELAAVCGDPSTDPPLLTRARHQHHLQGCLDALGHYKQ
SKDLALAAEALRVARGHLTRLTGGGGTEEILDIIFQDFCVGK
Simboli

Funkcija[uredi | uredi izvor]

Smatra se da modifikacija mitohondrijske tRNK GTPaza katalizira stvaranje 5-taurinometiluridina (τm (5) U) u položaju antikodonskog vezanja pet mitohondrijskih tRNK.[9] Gen je prvi put otkriven kod kvasca, gdje je utvrđeno da mutacija homologa kvasca ljudskogog GTPBP3, MSS1, izaziva respiratorni defekt u kvascu samo kada je prisutana mitohondrijska155 rRNK P (R) 454. Potonja je ekvivalentna ljudskoj mutaciji 12 rRNK A1555G, za koju je utvrđeno da asocira na gluhoću. Stoga su GTPBP3 i njegova homologna funkcija kvasca u modifikaciji mitohondrijske funkcije. U ljudi se GTPBP3 sveprisutno eksprimira u više tkiva u više transkripata.<ef name = "ReferenceA"/> Smatra se da kao enzim za modifikaciju tRNK djeluje tako da modificira interakciju kodon-antikodon, što je u skladu s njegovom modifikacijom težine fenotipova u mutaciji 12S rRNA A1555G ..

Klinički značaj[uredi | uredi izvor]

Poznato je da mutacije u GTPBP3 uzrokuju hipertrofijsku kardiomiopatiju i mitohondrijske defekte.[9] Osobe sa homozigotnom ili spojenom heterozigotnom mutacijom u GTPBP3 su sa kombiniranim nedostatkom kompleksa đrespratornog lanca u skeletnim mišićima,[9] koji zahtijevaju mitohondrijsku translaciju mitohondrijskih kodiranih složenih podjedinica za sastavljanje. Mutacije GTPBP3 uzrokuju ozbiljne nedostatke mitohondrijske translacije. Većina karakteriziranih ispitanika imala je laktacidozu i kardiomiopatiju.

Polimorfizmi valina 250 na GTPBP3 povezani su sa ozbiljnošću gluhoće, izazvane aminoglikozidima kod ljudi, bolesti povezane sa homoplazmatskom A1555G mutacijom u 12S rRNK kodiranim mitohondrijama, a karakterizira je gluhoća, koja varira od urođenog gubitka sluha do normalnog slušanje.

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000130299 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000007610 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Magrini SM, Papi MG, Marletta F, Tomaselli S, Cellai E, Mungai V, Biti G (Apr 1993). "Chordoma-natural history, treatment and prognosis. The Florence Radiotherapy Department experience (1956-1990) and a critical review of the literature". Acta Oncologica. 31 (8): 847–51. doi:10.3109/02841869209089717. PMID 1290633.
  6. ^ a b c d e "Entrez Gene: GTPBP3 GTP binding protein 3 (mitochondrial)".
  7. ^ a b c Li X, Guan MX (2002). "A human mitochondrial GTP binding protein related to tRNA modification may modulate phenotypic expression of the deafness-associated mitochondrial 12S rRNA mutation". Mol. Cell. Biol. 22 (21): 7701–11. doi:10.1128/mcb.22.21.7701-7711.2002. PMC 135671. PMID 12370316.
  8. ^ a b Villarroya M, Prado S, Esteve JM, Soriano MA, Aguado C, Pérez-Martínez D, Martínez-Ferrandis JI, Yim L, Victor VM, Cebolla E, Montaner A, Knecht E, Armengod ME (2008). "Characterization of human GTPBP3, a GTP-binding protein involved in mitochondrial tRNA modification". Mol. Cell. Biol. 28 (24): 7514–31. doi:10.1128/MCB.00946-08. PMC 2593442. PMID 18852288.
  9. ^ a b c Kopajtich R, Nicholls TJ, Rorbach J, Metodiev MD, Freisinger P, Mandel H, Vanlander A, Ghezzi D, Carrozzo R, Taylor RW, Marquard K, Murayama K, Wieland T, Schwarzmayr T, Mayr JA, Pearce SF, Powell CA, Saada A, Ohtake A, Invernizzi F, Lamantea E, Sommerville EW, Pyle A, Chinnery PF, Crushell E, Okazaki Y, Kohda M, Kishita Y, Tokuzawa Y, Assouline Z, Rio M, Feillet F, Mousson de Camaret B, Chretien D, Munnich A, Menten B, Sante T, Smet J, Régal L, Lorber A, Khoury A, Zeviani M, Strom TM, Meitinger T, Bertini ES, Van Coster R, Klopstock T, Rötig A, Haack TB, Minczuk M, Prokisch H (2014). "Mutations in GTPBP3 cause a mitochondrial translation defect associated with hypertrophic cardiomyopathy, lactic acidosis, and encephalopathy". Am. J. Hum. Genet. 95 (6): 708–20. doi:10.1016/j.ajhg.2014.10.017. PMC 4259976. PMID 25434004.

Dopunska literatura[uredi | uredi izvor]