ESD (gen)

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
ESD (gen)
Dostupne strukture
PDBPretraga Human UniProta: PDBe RCSB
Spisak PDB ID kodova

3FCX

Identifikatori
AliasiESD
Vanjski ID-jeviOMIM: 133280 MGI: 3781082 HomoloGene: 55623 GeneCards: ESD
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za ESD (gen)
Genomska lokacija za ESD (gen)
Bend13q14.2Početak46,771,256 bp[1]
Kraj46,797,420 bp[1]
Obrazac RNK ekspresije
PBB GE ESD 215096 s at fs.png

PBB GE ESD 209009 at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija S-formylglutathione hydrolase activity
methylumbelliferyl-acetate deacetylase activity
GO:0004091 carboxylic ester hydrolase activity
GO:0001948, GO:0016582 protein binding
hydrolase activity
hydrolase activity, acting on ester bonds
identical protein binding
Ćelijska komponenta citoplazma
Egzosom
endoplasmic reticulum lumen
GO:0016023 citoplazmatska vezikula
citosol
Biološki proces formaldehyde catabolic process
glutathione derivative biosynthetic process
GO:0022610 biološki proces
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001984

XM_036158963

RefSeq (bjelančevina)

NP_001975

n/a

Lokacija (UCSC)Chr 13: 46.77 – 46.8 Mbn/a
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Esteraza D, znana i kao S-formilglutation-hidrolaza je enzim koji je kod ljudi kodiran genom ESD.[4]

Gen ESD nalazi se na hromosomu 13, u raspo baznog para 13:46,771,255 do 46,797,699 bp.

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 282 aminokiseline, a molekulska težina 31 463 Da.[5]

1020304050
MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW
LSGLTCTEQNFISKSGYHQSASEHGLVVIAPDTSPRGCNIKGEDESWDFG
TGAGFYVDATEDPWKTNYRMYSYVTEELPQLINANFPVDPQRMSIFGHSM
GGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQSKWK
AYDATHLVKSYPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPV
VFRLQEGYDHSYYFIATFITDHIRHHAKYLNA
Simboli

Lokacija, struktura i funkcija[uredi | uredi izvor]

Hopkinson et al. (1973) opisali su esterazu crvenih krvnih zrnaca koju su nazvali esteraza D (EC 3.1.1.1). Iako je proučavana u hemolizatima crvenih krvnih ćelija, esteraza D je pronađena u mnogim različitim tkivima, uključujući kultivirane fibroblaste i limfocitoidne ćelije. Genetički polimorfizam otkriven je u evropeidnim, negroidnom i imdijskim populacijama. Cowell et al (1986.) pokazali su da postoji dosljedno niži nivo aktivnosti enzima esteraze D kod osoba sa 2-2 fenotipom, kada se aktivnost mjeri na određene načine. Naglasili su važnost provjere elektroforetskog fenotipa prije nego su zaključili da je delecija hromosoma 13 prisutna u porodici koja je proučavana u vezi s retinoblastomom (vidi kasnije). Munier et al. (1988) pregledali su 16 rijetkih alela na ESD lokusu i prijavili prethodno neopisanu varijantu u portugalskoj porodici. Podatke o učestalosti gena alelnih varijanti tabelirali su Roychoudhury i Nei (1988).

Iz istraživanja hibrida somatskih ćelija, Van Heyningen et al. (1975) zaključili su da lokus esteraze D može biti na kromosomu 13. Istim metodom, Chen et al. (1975) takođe dodeljuju ovaj lokus na hromosomu 13. Namboodiri et al. (1977) zaključili su da su Lp i esteraza D blisko povezani; lod skor bio je 2,32, pri rekombinacionoj frakciji od 0,0. Međutim, Greger et al. (1988) isključili su vezu LPA ne samo sa ESD-om već i sa RB1. (Naknadno je lociranje LPA mapirano na 6q27.) Sparkes et al. (1980) otkrili su da kvantitativna i kvalitativna ekspresija esteraze D u pet osoba s djelomičnom delecijom ili duplikacijom hromosoma 13 podržava lokalizaciju gena na 13q14. Nađeno je da je ista traka/pruga deletirana u slučajevima retinoblastoma. Predložili su da treba tražiti vezu porodičnog retinoblastoma i esteraze D, kako bi se provjerilo predstavlja li porodični retinoblastom mutaciju na istom mjestu kao i ono deletirano u 'hromosomskom' obliku poremećaja, te, ako je veza pronađena, osigurao način genetičkog savjetovanja i rane dijagnoze, uključujući prenatalnu. Rivera et al. (1981) zaključili su da su retinoblastomski i esterazni D lokusi u proksimalnoj polovini 13q14 pojasa. Mohandas et al. (1982) otkrili su da hibridni klonovi mišje-ljudskih ćelija koji zadržavaju ljudsku translokaciju X/13 ne eksprimiraju esterazu D. Sugerirali su da to može odražavati širenje inaktivacije u autosomnom dijelu hromosomske translokacije. Tačka prekida u hromosomu 13 bila je 13q12.

Translokaciju X/13 kod pacijenta koji je imao bilateralni retinoblastom i nije uspio napredovati, identificirali su Cross et al. (1977) i dalje proučavali Nichols et al. (1980), koji su predložil da, budući da je translokacijski hromosom kasnije označen, pacijentica je u većini ćelijabila efektivno monosomična za 13q14. (Couturier i sur. (1979) dali su uporedivo objašnjenje za nisku razinu superoksid-dismutaze koja je pronađena u slučaju translokacije X/21.) Kod pacijenata s retinoblastomom i delecijom 13q14,1–q22,3, Sparkes et al. (1984) otkrili su da je lokus esteraze D očigledno netaknut-nivoi aktivnosti enzima bili su normalni u crvenim krvnim zrncima i u fibroblastima. Ovo je pokazalo da je redoslijed gena: centromera-ESD-RB1. Frydman et al. (1985) istraživali su povezanost Wilsonove bolesti (WD) sa 27 autosomnih markera. Lodna ocjena 3,21 pronađena je pri Ɵ = 0,06 za povezivanje WD-a i esteraze D na hromosomu 13. U bilješci dodanoj u dokaz, oni su naveli da su s WD-om upisali drugi nepovezani 10-člani srodnik; maksimalna ocjena lod-a bila je 1,48 pri Ɵ = 0, dajući kombiniranu maksimalnu ocjenu lod-a 4,55 pri Ɵ = 0,04. Bonne-Tamir et al (1985) potvrdili su vezu WD -a sa esterazom D studijama druge inbred grupe, dvanepovezana Druza. Kombinirani rezultat lod-a bio je 5,49 pri Ɵ = 0,03. Hibridizacijom in situ , Duncan et al. (1987) dodijelili ESD-u lokus 13q14.2–q14.3. Ponovno ispitivanje pacijenta čiji su hromosomi bili osnova studije, Sparkes et al. (1984) sugerirali su da ESD lokus može biti distalno, a ne proksimalno od lokusa retinoblastoma. Suprotan zaključak temeljili su na činjenici da je nivo enzimske aktivnosti esteraze D bio normalan u retinoblastomskom tkivu. Kvantitativna hibridizacija in situ, prema Duncan et al. (1987.) smatrana je kao deletirani lokus izbrisan s jednog i dupliciran na drugom hromosomu 13. Nisu mogli ponuditi jednostavno objašnjenje za nedosljednost svojih rezultata delecijama koje su opisali Ward et al. (1984) koji je mapirao ESD lokus na 13q14.11. Studijama relativno velike delecije, 13q14-q31, u slučaju retinoblastoma, Mitchell i Cowell (1988) su potvrdili da se ESD nalazi proksimalno od RB1; nivo esteraze D je bio normalan. Lee i Lee (1986.) klonirali su ESD cDNK skriningom biblioteke ekspresija antitijelom protiv ESD-a. Squire et al. (1986) klonirali su gen ESD pomoću oligonukleotida specifičnih za parcijalnu aminokiselinsku sekvencu prečišćenog enzima. RFLP koristan za identifikaciju nostelja retinoblastoma pronađen je u kloniranom genu. Ova dva klona bi trebala biti od pomoći pri "hodanju" do retinoblastoma i lokusa Wilsonove bolesti.

Eiberg i Mohr (1986.) zaključili su da je S-formilglutation-hidrolaza (EC 3.1.2.12) isto što i esteraza D. Proučavali su polimorfizam FGH ljudskih crvenih krvnih ćelija u nepovezanih osoba, izoelektričnim fokusiranjem i elektroforezom sa škrob-gelom, te sa supstratima. S-acetilglutation i 4-metilumbeliferil-acetat (standardni supstrat za ESD). S obje tehnike razdvajanja, dvije podloge su dosljedno davale slične i identično locirane zimograme. Analizom podataka o porodicama, populacijama i hibridima somatskih ćelija, Apeshiotis i Bender (1986.) su također zaključili da su polimorfizmi FGH i ESD identični. Akiyama i Abe (1986.) izvijestili su o učestalosti gena za polimorfizam FGH na japanskom, te su također zaključili da su FGH i esteraza D identični. Uotila (1984) je pokazao polimorfizam FGH crvenih krvnih zrnaca kod Finaca. Poput S-hidroksiacil-glutation-hidrolaze (glioksalaze II), S-formilglutation-hidrolaza je enzim sposoban za hidrolizaciju tiol-estera glutationa. Čini se da je FGH uključen u uklanjanje formaldehida koji se prvo pretvara u S-formilglutation, reakcijom s glutationom i NAD-om (kataliziranim formaldehid-dehidrogenazom). FGH katalizira hidrolizu S-formilglutationa do reduciranog glutationa i formata. Hemolizati crvenih krvnih zrnaca frakcionirani su izoelektričnim fokusiranjem na poliakrilamidni gel i FGH locirani bojenjem po aktivnosti. Uzorci svih, osim šest od 242 proučena Finca, pokazali su jednu traku, dok su kod šest osoba pronađene po tri enzimske trake. Enzim je dimer i primijećeni polimorfizam je rezultat djelovanja alela, FGH (1) i FGH (2). Učestalost uobičajenog alela procijenjena je na 0,988. Nije pronađena homozigotna osoba za rijetki alel. Porodične studije nisu prijavljene. Board i Coggan (1986.) otkrili su elektroforetsku varijaciju FGH u crvenim krvnim zrncima i zaključili da je polimorfizam produkt dva alela na jednom autosomnom lokusu. Čini se da mnoga druga tkiva pokazuju istu ekspresiju gena.

  • Napomena: Svi pomenuti autori citirani su prema OMIM-u. [6]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000139684 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Entrez Gene: ESD esterase D/formylglutathione hydrolase".
  5. ^ "UniProt, P10768". Pristupljeno 2017-09-11. CS1 održavanje: nepreporučeni parametar (link)
  6. ^ https://omim.org/entry * 133280 - ESTERASE D; ESD

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]