NUDT4

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
NUDT4
Protein NUDT4 PDB 2duk.png
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2DUK

Identifikatori
AliasiNUDT4
Vanjski ID-jeviOMIM: 609229 MGI: 1918457 HomoloGene: 41726 GeneCards: NUDT4
Lokacija gena (čovjek)
Hromosom 12 (čovjek)
Hrom.Hromosom 12 (čovjek)[1]
Hromosom 12 (čovjek)
Genomska lokacija za NUDT4
Genomska lokacija za NUDT4
Bend12q22Početak93,377,883 bp[1]
Kraj93,408,146 bp[1]
Lokacija gena (miš)
Hromosom 10 (miš)
Hrom.Hromosom 10 (miš)[2]
Hromosom 10 (miš)
Genomska lokacija za NUDT4
Genomska lokacija za NUDT4
Bend10|10 C2Početak95,547,007 bp[2]
Kraj95,564,146 bp[2]
Obrazac RNK ekspresije
PBB GE NUDT4 206302 s at fs.png

PBB GE NUDT4 212181 s at fs.png

PBB GE NUDT4 206303 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija inositol diphosphate tetrakisphosphate diphosphatase activity
inositol-1-diphosphate-2,3,4,5,6-pentakisphosphate diphosphatase activity
inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity
metal ion binding
GO:0001948 protein binding
RNA binding
inositol-3-diphosphate-1,2,4,5,6-pentakisphosphate diphosphatase activity
hydrolase activity
diphosphoinositol-polyphosphate diphosphatase activity
inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 1-diphosphatase activity
inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
inositol diphosphate pentakisphosphate diphosphatase activity
inositol bisdiphosphate tetrakisphosphate diphosphatase activity
endopolyphosphatase activity
bis(5'-adenosyl)-hexaphosphatase activity
bis(5'-adenosyl)-pentaphosphatase activity
m7G(5')pppN diphosphatase activity
snoRNA binding
Ćelijska komponenta intracellular anatomical structure
Jedro
citoplazma
citosol
Biološki proces GO:0007243 intracellular signal transduction
cyclic nucleotide metabolic process
inositol phosphate metabolic process
cyclic-nucleotide-mediated signaling
calcium-mediated signaling
diphosphoinositol polyphosphate metabolic process
diadenosine pentaphosphate catabolic process
diadenosine hexaphosphate catabolic process
adenosine 5'-(hexahydrogen pentaphosphate) catabolic process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001301022
NM_001301023
NM_001301024
NM_019094
NM_199040

NM_027722
NM_001358996

RefSeq (bjelančevina)

NP_001287951
NP_001287952
NP_001287953
NP_061967
NP_950241

NP_081998
NP_001345925

Lokacija (UCSC)Chr 12: 93.38 – 93.41 MbChr 10: 95.55 – 95.56 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Difosfoinozitol polifosfat-fosfohidrolaza 2 je enzim koji je kod ljudi kodiran genom NUDT4.[5][6][7]

Protein kodiran ovim genom regulira promet polifosfat-difosfoinozitola. Promet ovih visokoenergetskih difosfoinozitol-polifosfata predstavlja aktivnost promjene molekula sa važnim regulatornim posljedicama. Molekulskno prebacivanje difosfoinozitol-polifosfata može doprinijeti regulaciji unutarčelijskog prometa. Opisano je nekoliko alternativno prerađenih varijanti transkripta, ali priroda nekih od njih nije utvrđena cijelom dužinom. Izoforme DIPP2alfa i DIPP2beta međusobno se razlikuju samo po tome što DIPP2beta ima jednu dodatnu aminokiselinu zbog pomjeranja granice introna u alternativnoj preradi.[7]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 180 aminokiselina, a molekulska težina 20.306 Da.[8].

1020304050
MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPG
GGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHRTYVYVLTV
TEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPA
NGNSTVPSLPDNNALFVTAAQTSGLPSSVR
Simboli


Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000173598 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000020029 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Caffrey JJ, Safrany ST, Yang X, Shears SB (Jun 2000). "Discovery of molecular and catalytic diversity among human diphosphoinositol-polyphosphate phosphohydrolases. An expanding Nudt family". J Biol Chem. 275 (17): 12730–6. doi:10.1074/jbc.275.17.12730. PMID 10777568.
  6. ^ Caffrey JJ, Shears SB (May 2001). "Genetic rationale for microheterogeneity of human diphosphoinositol polyphosphate phosphohydrolase type 2". Gene. 269 (1–2): 53–60. doi:10.1016/S0378-1119(01)00446-2. PMID 11376937.
  7. ^ a b "Entrez Gene: NUDT4 nudix (nucleoside diphosphate linked moiety X)-type motif 4".
  8. ^ "UniProt, Q9NZJ9". Pristupljeno 2021-08-12. CS1 održavanje: nepreporučeni parametar (link)

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]