NRGN

S Wikipedije, slobodne enciklopedije
(Preusmjereno sa Neurogranin)
Idi na navigaciju Idi na pretragu
NRGN
Identifikatori
AliasiNRGN
Vanjski ID-jeviOMIM: 602350 HomoloGene: 136802 GeneCards: NRGN
Lokacija gena (čovjek)
Hromosom 11 (čovjek)
Hrom.Hromosom 11 (čovjek)[1]
Hromosom 11 (čovjek)
Genomska lokacija za NRGN
Genomska lokacija za NRGN
Bend11q24.2Početak124,739,942 bp[1]
Kraj124,747,210 bp[1]
Ontologija gena
Molekularna funkcija phosphatidic acid binding
phosphatidylinositol-3,4,5-trisphosphate binding
calmodulin binding
Ćelijska komponenta citoplazma
Akson
trans-Golgi network transport vesicle membrane
neuronal cell body
dendrit
sinapsa
dendritic spine head
mitochondrial membrane
Jedro
GO:0097483, GO:0097481 postsynaptic density
postsynaptic membrane
postsynapse
glutamatergic synapse
citosol
Biološki proces telencephalon development
associative learning
positive regulation of long-term synaptic potentiation
GO:0072468 signal transduction
nervous system development
postsynaptic modulation of chemical synaptic transmission
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_006176
NM_001126181

n/a

RefSeq (bjelančevina)

NP_001119653
NP_006167

n/a

Lokacija (UCSC)Chr 11: 124.74 – 124.75 Mbn/a
PubMed pretraga[2]n/a
Wikipodaci
Pogledaj/uredi – čovjek
Neurogranin (C-supstrat protein-kinaze, RC3)
Identifikatori
SimbolNRGN
NCBI gen4900
HGNC8000
OMIM602350
RefSeqNM_006176
UniProtQ92686
Ostali podaci
LokusHrom. 11 q24
Pretraga za
StruktureSwiss-model
DomeneInterPro

Neurogranin je protein koji se veže za kalmodulin, eksprimirani prvenstveno u mozgu, posebno u dendritskoj kičmi, i učestvujući u signalnom putu protein kinaza C. Neurogranin je glavni postsinapsni protein koji regulira dostupnost kalmodulina i veže se za njega u nedostatku kalcija. Fosforilacija protein-kinazom C smanjuje njegovu sposobnost vezivanja. Ekspresiju gena NRGN kontroliraju hormoni štitnjače.[3]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 78 aminokiselina.

1020304050
MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGE
RGRKGPGPGGPGGAGVARGGAGGGPSGD

Jedno istraživanje govori o potencijalnoj vezi gena za neurogranin s povećanim rizikom od shizofrenije kod muškaraca,[4] drugo istraživanje daje dokaze o sniženom neurograninu imunoreaktivnost u mozgu ljudi koji boluju od shizofrenije.[5]

Koncentracija neurogranina u cerebrospinalnoj tekućini (CSF) dalje se raspravlja kao marker za sinapsnu disfunkciju u starosnoj neurodegeneraciji.[6] Također se pokazalo da se posebno povećava u pacijenata s Alzheimerovom bolešću.[7][8] Posebno omjer neurograninskog trupa cerebrospinalne tečnosti P75 i beta-sekretaze BACE1 se predlaže kao potencijalni marker za kognitivno pogoršanje u napretku Alzheimerove bolesti.[9]

Prije identifikacije u goveđem i pacovskom mozgu 1991,[10] neurogranin je bio poznat kao pretpostavljeni protein kinaza C-fosforilirani protein zvani p17. Ljudski neurogranin kloniran je 1997. godine i pokazalo se da je 96% identičan proteinu pacova.[11]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000154146 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ Martínez de Arrieta C, Morte B, Coloma A, Bernal J (January 1999). "The human RC3 gene homolog, NRGN contains a thyroid hormone-responsive element located in the first intron". Endocrinology. 140 (1): 335–43. doi:10.1210/en.140.1.335. PMID 9886843.
  4. ^ Ruano D, Aulchenko YS, Macedo A, Soares MJ, Valente J, Azevedo MH, et al. (January 2008). "Association of the gene encoding neurogranin with schizophrenia in males". Journal of Psychiatric Research. 42 (2): 125–33. doi:10.1016/j.jpsychires.2006.10.008. PMID 17140601.
  5. ^ Broadbelt K, Ramprasaud A, Jones LB (October 2006). "Evidence of altered neurogranin immunoreactivity in areas 9 and 32 of schizophrenic prefrontal cortex". Schizophrenia Research. 87 (1–3): 6–14. doi:10.1016/j.schres.2006.04.028. PMID 16797925. S2CID 38984915.
  6. ^ Casaletto KB, Elahi FM, Bettcher BM, Neuhaus J, Bendlin BB, Asthana S, et al. (October 2017). "Neurogranin, a synaptic protein, is associated with memory independent of Alzheimer biomarkers". Neurology. 89 (17): 1782–1788. doi:10.1212/WNL.0000000000004569. PMC 5664306. PMID 28939668.
  7. ^ De Vos A, Jacobs D, Struyfs H, Fransen E, Andersson K, Portelius E, et al. (December 2015). "C-terminal neurogranin is increased in cerebrospinal fluid but unchanged in plasma in Alzheimer's disease". Alzheimer's & Dementia. 11 (12): 1461–1469. doi:10.1016/j.jalz.2015.05.012. PMID 26092348.
  8. ^ Willemse EA, De Vos A, Herries EM, Andreasson U, Engelborghs S, van der Flier WM, et al. (June 2018). "Neurogranin as Cerebrospinal Fluid Biomarker for Alzheimer Disease: An Assay Comparison Study". Clinical Chemistry. 64 (6): 927–937. doi:10.1373/clinchem.2017.283028. PMID 29523639.
  9. ^ De Vos A, Struyfs H, Jacobs D, Fransen E, Klewansky T, De Roeck E, et al. (July 2016). "The Cerebrospinal Fluid Neurogranin/BACE1 Ratio is a Potential Correlate of Cognitive Decline in Alzheimer's Disease". Journal of Alzheimer's Disease. 53 (4): 1523–38. doi:10.3233/JAD-160227. PMC 4981899. PMID 27392859.
  10. ^ Baudier J, Deloulme JC, Van Dorsselaer A, Black D, Matthes HW (January 1991). "Purification and characterization of a brain-specific protein kinase C substrate, neurogranin (p17). Identification of a consensus amino acid sequence between neurogranin and neuromodulin (GAP43) that corresponds to the protein kinase C phosphorylation site and the calmodulin-binding domain". The Journal of Biological Chemistry. 266 (1): 229–37. PMID 1824695.
  11. ^ Martínez de Arrieta C, Pérez Jurado L, Bernal J, Coloma A (April 1997). "Structure, organization, and chromosomal mapping of the human neurogranin gene (NRGN)". Genomics. 41 (2): 243–9. doi:10.1006/geno.1997.4622. PMID 9143500.

Vanjski linkovi[uredi | uredi izvor]