ATP7B

S Wikipedije, slobodne enciklopedije
ATP7B
PBB Protein ATP7B image.jpg
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2ROP, 2EW9, 2KOY, 2LQB

Identifikatori
AliasiATP7B
Vanjski ID-jeviOMIM: 606882 MGI: 103297 HomoloGene: 20063 GeneCards: ATP7B
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za ATP7B
Genomska lokacija za ATP7B
Bend13q14.3Početak51,930,436 bp[1]
Kraj52,012,125 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za ATP7B
Genomska lokacija za ATP7B
Bend8 A2|8 10.78 cMPočetak22,482,801 bp[2]
Kraj22,550,321 bp[2]
Obrazac RNK ekspresije
PBB GE ATP7B 204624 at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija nucleotide binding
metal ion binding
GO:0004008 P-type divalent copper transporter activity
ATPase-coupled cation transmembrane transporter activity
GO:0001948, GO:0016582 protein binding
copper ion binding
hydrolase activity
ATP binding
copper ion transmembrane transporter activity
Ćelijska komponenta citoplazma
integral component of membrane
trans-Golgi network membrane
membrana
Golđijeva membrana
integral component of plasma membrane
trans-Golđijeva mreža
basolateral plasma membrane
mitohondrija
perinuklearno područje citoplazme
endozom
late endosome
Golđijev aparat
GO:0016023 citoplazmatska vezikula
Biološki proces protein maturation by copper ion transfer
copper ion transmembrane transport
GO:0070839 metal ion transport
copper ion import
cation transport
ion transport
copper ion export
ion transmembrane transport
sequestering of calcium ion
cellular zinc ion homeostasis
cellular copper ion homeostasis
lactation
response to copper ion
copper ion transport
GO:0015915 transport
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000053
NM_001005918
NM_001243182
NM_001330578
NM_001330579

NM_007511

RefSeq (bjelančevina)
NP_000044
NP_001005918
NP_001230111
NP_001317507
NP_001317508

NP_000044.2
NP_000044.2
NP_001005918.1
NP_001230111.1

NP_031537
NP_001390638

Lokacija (UCSC)Chr 13: 51.93 – 52.01 MbChr 8: 22.48 – 22.55 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Fiziološki put bakra u ljudskom tijelu. Cu = bakar, CP = ceruloplazmin, protein ATP7B je u hepatocitima.
Jednostavni model strukturnih karakteristika proteina ATP7B. Cu = Motiv vezivanja bakra

Protein Wilsonove bolesti (WND), poznat i kao ATP7B protein, transportira bakar P-tip ATPaza, koji je kodiran genom ATP7B. Protein ATP7B nalazi se u trans-Golgijevoj mreži jetre i mozga i uravnotežuje nivo bakra u tijelu, izlučujući višak u žuč i plazmu. Genetički poremećaj gena ATP7B može izazvati Wilsonovu bolest, bolest kod koje se bakar akumulira u tkivima, što dovodi do nervnih ili psihijatrijskih problema i bolesti jetre.

Gen[uredi | uredi izvor]

Protein Wilsonove bolesti povezan je s genom ATP7B, sa približno 80 Kb, koji se nalazi na ljudskom hromosomu 13 i sastoji se od 21 egzona. Transkribirana iRNK gena "ATP7B" ima veličinu od 7,5 Kb i kodira protein od 1465 aminokiselina.[5]

Gen je član transportnog kationa porodice P-tipa ATPaza i kodira protein sa nekoliko domena koji se protežu kroz membranu, ATPaznu konsenzusnu sekvencu, zglobni domen, fosforilacijsko mjesto i najmanje dva pretpostavljena mjesta vezanja bakra. Ovaj protein funkcionira kao monomer koji eksportira bakar iz ćelija, kao što je isticanje jetrenog bakra u žuč. Okarakterizirane su alternativne transkripcijske varijante prerade, koje kodiraju različite izoforme, s različitim ćelijkskim) lokalizacijama.[6] Wilsonova bolest uzrokovana je različitim mutacijama. Jedna od uobičajenih mutacija je mutacija jednobaznog para, H1069Q..[5]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 1.465 aminokiselina, a molekulska težina 157.263 Da.[7].

1020304050
MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDG
LGPSSQVATSTVRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATV
KYVPSVVCLQQVCHQIGDMGFEASIAEGKAASWPSRSLPAQEAVVKLRVE
GMTCQSCVSSIEGKVRKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDH
VNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSANQNFNNSETLG
HQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVK
YDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPP
RNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTAT
VLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAGNSMVQTTD
GTPTSVQEVAPHTGRLPANHAPDILAKSPQSTRAVAPQKCFLQIKGMTCA
SCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLG
FEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALA
TSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKMEIKQW
KKSFLCSLVFGIPVMALMIYMLIPSNEPHQSMVLDHNIIPGLSILNLIFF
ILCTFVQLLGGWYFYVQAYKSLRHRSANMDVLIVLATSIAYVYSLVILVV
AVAEKAERSPVTFFDTPPMLFVFIALGRWLEHLAKSKTSEALAKLMSLQA
TEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFPVDGKVLEGNT
MADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIV
KLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVV
QRYFPNPNKHISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTG
VAAQNGILIKGGKPLEMAHKIKTVMFDKTGTITHGVPRVMRVLLLGDVAT
LPLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETLGYCTDFQAVPGC
GIGCKVSNVEGILAHSERPLSAPASHLNEAGSLPAEKDAVPQTFSVLIGN
REWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQ
EAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVA
KVQELQNKGKKVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLI
RNDLLDVVASIHLSKRTVRRIRINLVLALIYNLVGIPIAAGVFMPIGIVL
QPWMGSAAMAASSVSVVLSSLQLKCYKKPDLERYEAQAHGHMKPLTASQV
SVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGD
KWSLLLNGRDEEQYI
Simboli

Struktura[uredi | uredi izvor]

Protein ATP7B je transporter bakra P-tip ATPaza, sintetiziran kao membranski protein od 165 KDa u ćelijskoj liniji ljudskog hepatoma,[5] i koji je 57% homologan sa pridruženim proteinom ATP7A Menkesove bolesti.[8]

ATP7B se sastoji od nekoliko domena:

CPC motiv (Cys-Pro-Cys) u transmembranskom segmentu 6 karakterizira protein kao transporter teškometalnih ATPaza.[9]

Motiv vezivanja bakra također pokazuje visok afinitet prema drugim ionima prijelaznih metala kao što su cink Zn (II), kadmij Cd (II), zlato Au (III) i živa Hg (II). Međutim, bakar može smanjiti afinitet vezivanja cinka pri niskoj koncentraciji i dramatično povećati afinitet vezanja bakra sa povećanjem koncentracije, kako bi se osiguralo snažno vezivanje između motiva i bakra.[9]

Kao P-tip ATPaza, ATP7B prolazi kroz autofosforilaciju, ključ konzerviraniog ostatka asparaginske kiseline (D) u motivu DKTGT. Vezivanje ATP-a za protein pokreće reakciju, a bakar se veže za transmembransko područje. Tada dolazi do fosforilacije u ostatku asparaginske kiseline u motivu DKTGT, sa oslobađanjem Cu. Zatim defosforilacija ostatka asparaginske kiseline oporavi protein, kako bi bio spreman za sljedeći transport.[10]

Funkcija[uredi | uredi izvor]

Većina proteina ATP7B nalazi se u trans-Golgijevoj mreži (TGN) hepatocita, što se razlikuje od njegovog homolognog proteina ATP7A.[11] Mala količina ATP7B nalazi se u mozgu.[12]

Kao protein koji prenosi bakar, jedna od glavnih funkcija je isporuka bakra enzimima ovisnim enzimima u Golgijevom aparatu (npr. holoceruloplazmin (CPN)).[11]

U ljudskom tijelu, jetra ima važnu ulogu u regulaciji razine bakra, uključujući uklanjanje viška.[11] ATP7B učestvuje u fiziološkom putu procesa uklanjanja bakra na dva načina: izlučivanjem bakra u [ [krvna plazma|plazmu]] i izlučivanje bakra u žuč.[8]

Interakcije[uredi | uredi izvor]

ATOX1[uredi | uredi izvor]

ATP7B prima bakar iz citosolnog proteina antioksidansa 1 bakrarnog šaperona (ATOX1). [5] Ovaj protein cilja ATP7B direktno u jetru radi transporta bakra. ATOX1 prenosi bakar iz citosola u domenu vezanja metala ATP7B koja kontrolira katalitičku aktivnost ATP7B. [13]

Nekoliko mutacija u ATOX1 može blokirati bakarske puteve i uzrokovati Wilsonovu bolest.[13]

GLRX[uredi | uredi izvor]

ATP7B stupa u interakciju sa glutaredoksinom-1 (GLRX). Naknadni transport promovira se smanjenjem intramolekulskih disulfidnih veza s GLRX katalizom.[14]

Povezanost sa Wilsonovom bolešću[uredi | uredi izvor]

Wilsonova bolest se javlja kada nakupljanje bakra unutar jetre uzrokuje mitohondrijska oštećenja i uništavanje ćelija i pokazuje simptome bolesti jetre. Tada gubitak izlučivanja bakra u žuči dovodi do sve veće koncentracije bakra u mokraći i uzrokuje probleme s bubrezima. Stoga simptomi Wilsonove bolesti mogu biti različiti, uključujući bolest bubrega i nervnu bolest.[13] Glavni uzrok je kvar ATP7B [13]s mutacijom jednog baznog para, delecijama, pomacima okvira, greške prerade u genu ATP7 .[5]

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000123191 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000006567 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b c d e f g h i j Terada K, Schilsky ML, Miura N, Sugiyama T (Oct 1998). "ATP7B (WND) protein". The International Journal of Biochemistry & Cell Biology. 30 (10): 1063–7. doi:10.1016/S1357-2725(98)00073-9. PMID 9785470.
  6. ^ "Entrez Gene: ATP7B ATPase, Cu++ transporting, beta polypeptide".
  7. ^ "UniProt, P35670". Pristupljeno 2017-09-11. CS1 održavanje: nepreporučeni parametar (link)
  8. ^ a b Harris ED (2000). "Cellular copper transport and metabolism". Annual Review of Nutrition. 20: 291–310. doi:10.1146/annurev.nutr.20.1.291. PMID 10940336.
  9. ^ a b Bertini I, Gray H, Stiefel E, Valentine J (2006). Biological inorganic chemistry:structure and reactivity. Sausalito, CA: University Science Books. ISBN 1-891389-43-2.
  10. ^ Banci L, Bertini I, Cantini F, Ciofi-Baffoni S (Aug 2010). "Cellular copper distribution: a mechanistic systems biology approach". Cellular and Molecular Life Sciences. 67 (15): 2563–89. doi:10.1007/s00018-010-0330-x. PMID 20333435.
  11. ^ a b c Lutsenko S, LeShane ES, Shinde U (Jul 2007). "Biochemical basis of regulation of human copper-transporting ATPases". Archives of Biochemistry and Biophysics. 463 (2): 134–48. doi:10.1016/j.abb.2007.04.013. PMC 2025638. PMID 17562324.
  12. ^ Crisponi G, Nurchi VM, Fanni D, Gerosa C, Nemolato S, Faa G (April 2010). "Copper-related diseases: From chemistry to molecular pathology". Coordination Chemistry Reviews. 254 (7–8): 876–889. doi:10.1016/j.ccr.2009.12.018.
  13. ^ a b c d Cox DW, Moore SD (Oct 2002). "Copper transporting P-type ATPases and human disease". Journal of Bioenergetics and Biomembranes. 34 (5): 333–8. doi:10.1023/A:1021293818125. PMID 12539960.
  14. ^ Lim CM, Cater MA, Mercer JF, La Fontaine S (Sep 2006). "Copper-dependent interaction of glutaredoxin with the N termini of the copper-ATPases (ATP7A and ATP7B) defective in Menkes and Wilson diseases" (PDF). Biochem. Biophys. Res. Commun. 348 (2): 428–36. doi:10.1016/j.bbrc.2006.07.067. hdl:10536/DRO/DU:30003772. PMID 16884690. Arhivirano s originala (PDF), 22. 4. 2021. Pristupljeno 30. 7. 2021.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Šablon:ATPaze Šablon:ATPaza Šablon:Metabolizam metala