BTBD14B

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
BTBD14B
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

3GA1, 4U2N

Identifikatori
AliasiNACC1
Vanjski ID-jeviOMIM: 610672 MGI: 1914080 HomoloGene: 12042 GeneCards: NACC1
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za BTBD14B
Genomska lokacija za BTBD14B
Bend19p13.13Početak13,116,862 bp[1]
Kraj13,141,147 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za BTBD14B
Genomska lokacija za BTBD14B
Bend8 C2|8 41.02 cMPočetak84,670,479 bp[2]
Kraj84,687,902 bp[2]
Obrazac RNK ekspresije
PBB GE BTBD14B gnf1h01189 s at fs.png

PBB GE BTBD14B gnf1h01188 at fs.png
Više referentnih podataka o ekspresiji
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_052876

NM_025788

RefSeq (bjelančevina)

NP_443108

NP_080064

Lokacija (UCSC)Chr 19: 13.12 – 13.14 MbChr 8: 84.67 – 84.69 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Jedarni akumbens-vezani protein 1 ili nukleusni akumbensni protein 1 je protein koji je kod ljudi kodiran genom NACC1.[5][6]

Članovi BTB / POZ porodice transkripcijskih regulatora, uključujući BTBD14B, sadrže konzervirani motiv u N-terminalnom području kritičnom za interakcije protein-protein i sklop kompleksa visoke molekulske mase.

Kloniranje i ekspresija[uredi | uredi izvor]

Pregledom biblioteke cDNK cijelog mozga pacova, s transkriptom koji je pokazao povećanu ekspresiju u jedrima pacova, nakon primjene kokaina, nakon čega slijedi RT-PCR, Cha et al. (1997) klonirani pacovski Btbd14b, kojeg su nazvali nucleus accumbens-1 (Nac1). Izvedeni protein od 514 aminokiselina sadrži domen POZ u prvih 120 aminokiselina.[7]

Korutla et al. (2002) identificirali su prerađenu varijantu pacova Btbd14b, kojoj je nedostajalo 27 aminokiselina iz srednje regije Btbd14b. I izvedene 514-aminokiselinske (lNac1) i 487-aminokiselinske (sNac1) izoforme sadrže N-terminalni POZ domen. RT-PCR analiza otkrila je iRNK obje izoforme u svim ispitivanim regijama mozga odraslih pacova, kao i u slezeni, skeletnim mišićima, srcu, bubrezima, timusu, sa mNNA lNac1 2,5 puta obilnijim od iRNK sNac1. Western blot analiza otkrila je i lNac1 i sNac1 u više regija zrelog CNS-a zrelih pacova, uključujući moždana jezgra, kaudatni putamen, mali mozak, olfaktornu kvržicu i prefrontalni korteks, s izoformom lNac1, koji je bio obilniji. Ekspresija lNac1 otkrivena je u srcu odraslom pacova, jetri, bubregu, slezeni, testisu i skeletnim mišićima, dok je sNac1 otkriven samo u jetri. Imunohistokemijska svojstva lNac1 i sNac1 pacova eksprimirana u ćelijama H293T obuhvataju obje izoforme u jezgru u tačkastoj distribuciji karakterističnoj za transkripcijske faktore BTB/POZ.

Funkcija gena[uredi | uredi izvor]

Koristeći Nac1 mutante pacova izražene u ćelijama H293T, Korutla et al. (2002) utvrdili su da i lNac1 i sNac1 potiskuju transkripciju reporter gena, pri čemu lNac1 pokazuje veću transkripcijsku represivnu aktivnost od sNac1.[8] Korutla et al. (2005) otkrili su da je transkripcijska represija posredovana Nac1 u kulturama neuronskih ćelija i u primarnim hipokampusnim neuronima djelimično poništena inhibitorima histonskih deacetilaza. Međutim, nije primijećena promjena na glijinim ćelijama. Dvohibridna analiza sisara, in vitro koimunoprecipitacija i GST testovi padajućeg postupka pokazali su da su i Nac1 izoforme u interakciji s HDAC3 i HDAC4 u NNA i PC12 ćelijama sličnim neuronima, ali ne i u neuronskim ćelijama H293T. Koristeći Nac1 izoforme i mutantne konstrukcije, pokazali su da se vezanje Nac1 za HDAC3 (605166) i HDAC4 dogodilo i preko POZ i izvan POZ domena. Korutla et al. (2005) sugeriraju da Nac1 regrutuje histonske deacetilaze i djeluje kao transkripcijski korektor u neuronskim ćelijama.[9]

Koristeći serijsku analizu ekspresije gena, Nakayama et al. (2006) otkrili su da je NAC1 značajno prekomjerno eksprimiran u seroznim karcinomima jajnika i nekoliko drugih tipova karcinoma. Imunohistokemijska analiza seroznih karcinoma jajnika lokalizirala je NAC1 u diskretnim jedarnim tijelima, što su autori nazvali NAC1 tijelima, a nivo ekspresije NAC1 korelirao s recidivom tumora. Intenzivna imunoreaktivnost NAC1 u primarnim tumorima predvidjela je rani recidiv u karcinomima jajnika. I imunoprecipitacija i dvostruko imunofluorescentno bojenje pokazali su da se NAC1 homodimerizuje preko BTB/POZ domena. Inducirana ekspresija domena NAC1 BTB/POZ poremetila je tijela NAC1, spriječila stvaranje tumora i promovirala apoptozu tumorskih ćelija u utvrđenim tumorima u modelu ksenotransplanta na mišu. Prekomjerna ekspresija NAC1 pune dužine povećala je tumorogenost epitelnih ćelija i fibroblasta na površini jajnika kod atipskih nu/nu miševa.

Nakayama et al. (2007) pokazali su da je NAC1 smanjio ekspresiju supresora tumora GADD45GIP1 u nekoliko ćelijskih linija ljudskog karcinoma. U tumorskim ćelijamama koje eksprimiraju NAC1, ekspresija dominantno negativnog NAC1 mutanta, koji sadrži samo BTB/POZ domen, inhibirala je rast ćelija, a taj je efekt djelimično poništen nokdaunom GADD45GIP1.[10]

Molekulska genetika[uredi | uredi izvor]

U sedam nepovezanih pacijenata s neurorazvojnim poremećajem s epilepsijom, kataraktom, poteškoćama u hranjenju i odgođenom mijelinizacijom mozga, Schoch et al. (2017) identificirali su ponovnu de novo heterozigotnu misens mutaciju u genu NACC1 (R298W). Jedan od pacijenata imao je mozaičnu mutaciju. Mutacija je pronađena sekvenciranjem cijelog egzoma, a potvrđena Sangerovim sekvenciranjem. Funkcionalne studije varijanti i studije ćelija pacijenta nisu potvrđene.[11][12]

Aminokiselinska sekvenca[uredi | uredi izvor]

Simboli
1020304050
MAQTLQMEIPNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAA
SSSYFRDLFNNSRSAVVELPAAVQPQSFQQILSFCYTGRLSMNVGDQFLL
MYTAGFLQIQEIMEKGTEFFLKVSSPSCDSQGLHAEEAPSSEPQSPVAQT
SGWPACSTPLPLVSRVKTEQQESDSVQCMPVAKRLWDSGQKEAGGGGNGS
RKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAG
GVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQI
CNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQ
IGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLR
RLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFAPN
FKESEMNAIAADMCTNARRVVRKSWMPKVKVLKAEDDAYTTFISETGKIE
PDMMGVEHGFETASHEGEAGPSAEALQ

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000160877 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000001910 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Strausberg RL, Feingold EA, Grouse LH, et al. (Dec 2002). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc Natl Acad Sci U S A. 99 (26): 16899–903. doi:10.1073/pnas.242603899. PMC 139241. PMID 12477932.
  6. ^ "Entrez Gene: BTBD14B BTB (POZ) domain containing 14B".
  7. ^ Cha, X. Y., Pierce, R. C., Kalivas, P. W., Macker, S. A. NAC-1, a rat brain mRNA, is increased in the nucleus accumbens three weeks after chronic cocaine self-administration. J. Neurosci. 17: 6864-6871, 1997. [PubMed]: 9278521
  8. ^ Korutla, L., Wang, P. J., Lewis, D. M., Neustadter, J. H., Stromberg, M. F., Mackler, S. A. Differences in expression, actions and cocaine regulation of two isoforms for the brain transcriptional regulator NAC1. Neuroscience 110: 421-429, 2002. [PubMed]: 11906783
  9. ^ Korutla, L., Wang, P. J., Mackler, S. A. The POZ/BTB protein NAC1 interacts with two different histone deacetylases in neuronal-like cultures. J. Neurochem. 94: 786-793, 2005. [PubMed]: 16033423
  10. ^ Nakayama, K., Nakayama, N., Davidson, B., Sheu, J. J.-C., Jinawath, N., Santillan, A., Salani, R., Bristow, R. E., Morin, P. J., Kurman, R. J., Wang, T.-L., Shih, I.-M. A BTB/POZ protein, NAC-1, is related to tumor recurrence and is essential for tumor growth and survival. Proc. Nat. Acad. Sci. 103: 18739-18744, 2006. [PubMed]: 17130457
  11. ^ Nakayama, K., Nakayama, N., Davidson, B., Sheu, J. J.-C., Jinawath, N., Santillan, A., Salani, R., Bristow, R. E., Morin, P. J., Kurman, R. J., Wang, T.-L., Shih, I.-M. A BTB/POZ protein, NAC-1, is related to tumor recurrence and is essential for tumor growth and survival. Proc. Nat. Acad. Sci. 103: 18739-18744, 2006. PubMed: 17130457
  12. ^ Nakayama, K., Nakayama, N., Wang, T.-L., Shih, I.-M. NAC-1 controls cell growth and survival by repressing transcription of Gadd45GIP1, a candidate tumor suppressor. Cancer Res. 67: 8058-8064, 2007. [PubMed]: 17804717

Vanjski linkovi[uredi | uredi izvor]

  • Lokacija ljuskog genoma NACC1 i stranica sa detaljima o genu NACC1 u UCSC Genome Browseru.
  • PDBe-KB provides an overview of all the structure information available in the PDB for Human Nucleus accumbens-associated protein 1 (BTBD14B)

Dopunska literatura[uredi | uredi izvor]