Idi na sadržaj

ETV5

S Wikipedije, slobodne enciklopedije
ETV5
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4UNO

Identifikatori
AliasiETV5
Vanjski ID-jeviOMIM: 601600 MGI: 1096867 HomoloGene: 3276 GeneCards: ETV5
Lokacija gena (čovjek)
Hromosom 3 (čovjek)
Hrom.Hromosom 3 (čovjek)[1]
Hromosom 3 (čovjek)
Genomska lokacija za ETV5
Genomska lokacija za ETV5
Bend3q27.2Početak186,046,314 bp[1]
Kraj186,110,318 bp[1]
Lokacija gena (miš)
Hromosom 16 (miš)
Hrom.Hromosom 16 (miš)[2]
Hromosom 16 (miš)
Genomska lokacija za ETV5
Genomska lokacija za ETV5
Bend16|16 B1Početak22,200,059 bp[2]
Kraj22,258,469 bp[2]
Ontologija gena
Molekularna funkcija vezivanje sa DNK
sequence-specific DNA binding
RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
GO:0001077, GO:0001212, GO:0001213, GO:0001211, GO:0001205 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001948, GO:0016582 vezivanje za proteine
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
Ćelijska komponenta nukleoplazma
jedro
ćelijska membrana
Biološki proces Ćelijska diferencijacija
GO:0009373 regulation of transcription, DNA-templated
locomotory behavior
regulation of branching involved in mammary gland duct morphogenesis
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
neuromuscular synaptic transmission
male germ-line stem cell asymmetric division
positive regulation of neuron differentiation
skeletal muscle acetylcholine-gated channel clustering
cellular response to oxidative stress
positive regulation of glial cell proliferation
GO:1904739 regulation of synapse organization
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
transcription by RNA polymerase II
GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_004454

NM_023794
NM_001358428

RefSeq (bjelančevina)

NP_004445

NP_076283
NP_001345357

Lokacija (UCSC)Chr 3: 186.05 – 186.11 MbChr 16: 22.2 – 22.26 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
ETS varijanta gena 5
(ETS-srodna molekula)
Identifikatori
SimbolETV5
Alt. simboliERM
NCBI gen2119
HGNC3494
OMIM601600
RefSeqNM_004454
UniProtP41161
Ostali podaci
LokusHrom. 3 q28
Pretraga za
StruktureSwiss-model
DomeneInterPro

Ets varijanta transkripcijskog faktora 5 (ETV5) (također pod nazivom ERM transkripcijski faktor) je transkripcijski faktor koji je kod ljudi kodiran gen om ETV5 sa hromosoma 3.[5] Generteaju ga Sertolijeve ćelije, koje se nalaze u sjemenicima i imaju ključnu ulogu u spermatogenezi. Njegov ortolog je povezan i sa gojaznošću i bipolarnim poremećajem.[6]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 510 aminokiselina, а molekulska težina 57.838 Da.[7]

1020304050
MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDL
SQLQEAWLAEAQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELS
SCSHEQALGANYGEKCLYNYCAYDRKPPSGFKPLTPPTTPLSPTHQNPLF
PPPQATLPTSGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQP
LQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEP
IVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYC
VDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVK
QEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIE
PEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCD
PDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSPAYLLDMDRCS
SLPYAEGFAY

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000244405 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000013089 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Ets variant 5".
  6. ^ Williams MJ, Klockars A, Eriksson A, Voisin S, Dnyansagar R, Wiemerslage L, Kasagiannis A, Akram M, Kheder S, Ambrosi V, Hallqvist E, Fredriksson R, Schiöth HB (juni 2016). "The Drosophila ETV5 Homologue Ets96B: Molecular Link between Obesity and Bipolar Disorder". PLOS Genetics. 12 (6): e1006104. doi:10.1371/journal.pgen.1006104. PMC 4900636. PMID 27280443.
  7. ^ "UniProt, P41161" (jezik: engleski). Pristupljeno 7. 11. 2021.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]