GBP2

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
GBP2
Identifikatori
AliasiGBP2
Vanjski ID-jeviOMIM: 600412 MGI: 102772 HomoloGene: 10289 GeneCards: GBP2
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za GBP2
Genomska lokacija za GBP2
Bend1p22.2Početak89,106,132 bp[1]
Kraj89,150,456 bp[1]
Lokacija gena (miš)
Hromosom 3 (miš)
Hrom.Hromosom 3 (miš)[2]
Hromosom 3 (miš)
Genomska lokacija za GBP2
Genomska lokacija za GBP2
Bend3 H1|3 66.69 cMPočetak142,620,602 bp[2]
Kraj142,638,008 bp[2]
Ontologija gena
Molekularna funkcija nucleotide binding
GTP binding
GO:0001948 protein binding
hydrolase activity
GO:0006184 GTPase activity
protein homodimerization activity
Ćelijska komponenta Golđijeva membrana
membrana
Nukleoplazma
citosol
actin cytoskeleton
Jedro
citoplazma
Golđijev aparat
perinuklearno područje citoplazme
symbiont-containing vacuole membrane
GO:0016023 citoplazmatska vezikula
Biološki proces type I interferon signaling pathway
Imuni odgovor
interferon-gamma-mediated signaling pathway
protein localization to nucleus
cellular response to interferon-gamma
cellular response to interleukin-1
cellular response to tumor necrosis factor
defense response to protozoan
GO:0051637 defense response to Gram-positive bacterium
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_004120

NM_010260

RefSeq (bjelančevina)

NP_004111

NP_034390

Lokacija (UCSC)Chr 1: 89.11 – 89.15 MbChr 3: 142.62 – 142.64 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Interferonom-inducirani gvanilat-vezujući protein 2 jest protein koji je kod ljudi kodiran genom GBP2 sa hromosoma 1.[5][6] GBP2 je gen koji se odnosi na natporodicu velikih GTPaza koje se mogu inducirati uglavnom interferonom gama.[7]

Amiokiselininska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 591 aminokiselina, a molekulska težina 67.209 Da. [8]

1020304050
MAPEINLPGPMSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTG
KSYLMNKLAGKKNGFSLGSTVKSHTKGIWMWCVPHPKKPEHTLVLLDTEG
LGDIEKGDNENDSWIFALAILLSSTFVYNSMGTINQQAMDQLHYVTELTD
RIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYL
ELSLKLRKGTDKKSKSFNDPRLCIRKFFPKRKCFVFDWPAPKKYLAHLEQ
LKEEELNPDFIEQVAEFCSYILSHSNVKTLSGGIPVNGPRLESLVLTYVN
AISSGDLPCMENAVLALAQIENSAAVEKAIAHYEQQMGQKVQLPTETLQE
LLDLHRDSEREAIEVFMKNSFKDVDQMFQRKLGAQLEARRDDFCKQNSKA
SSDCCMALLQDIFGPLEEDVKQGTFSKPGGYRLFTQKLQELKNKYYQVPR
KGIQAKEVLKKYLESKEDVADALLQTDQSLSEKEKAIEVERIKAESAEAA
KKMLEEIQKKNEEMMEQKEKSYQEHVKQLTEKMERDRAQLMAEQEKTLAL
KLQEQERLLKEGFENESKRLQKDIWDIQMRSKSLEPICNIL

Struktura[uredi | uredi izvor]

Analiza sekvence GBP2 pokazala je prisustvo RNK-vezujućeg domena koji se sastoji od tri motiva prepoznavanja RNK (RRM) i SR domena. Amino terminal GBp2 dijeli četiri motiva ponavljanja Arg-Gly-Gly (RGG) i devet serinskih ostataka u kontekstu arginin/serinskih motiva.[9]

SR domen GBP2 je mjesto fosforilacija za SR specifičnu protein-kinazu SRPK (sky1) koja usmjerava jedarnu lokalizaciju GBP2.

Svinjski GBP2 ima veliku sličnost u pogledu N-terminala koji je globulski domen i sadrži funkciju GTPaza. Međutim, C-terminal ima spiralni domen koji je manje konzerviran.[10]

Funkcija[uredi | uredi izvor]

Interferoni su citokini koji imaju antivirusne efekte i inhibiraju ćelijsku proliferaciju tumora. Indukuju veliki broj gena u svojim ciljnim ćelijama, uključujući i one koji kodiraju gvanilat-vezujući protein (GBP). GBP se odlikuju sposobnošću da specifično vežu guaninske nukleotide (GMP, GDP i GTP). Protein kodiran ovim genom je GTPaza koja pretvara GTP u GDP i GMP.[6] Osim toga, GBP2 gen može biti veza između površinskih ćelijskih receptore i unutarćelijskih efektora koji mogu prenijeti vanćelijske informacije u ćelije, kao i unutarćelijski signalni transdukcijski protein.[11]

Studija na goveđem genu GBP2 pokazala je važnost GBP2 u regulaciji proliferacije ćelija i otpornosti na infekciju patogenom, kao što je Izlaganje antivirusnoj aktivnosti protiv virusa gripe.[12]

GPB2 promovira oksidativno ubijanje i isporučuje antimikrobne peptide u autofagolizosom, pružajući široku zaštitu domaćina od različitih klasa patogena. Tokom virusne infekcije, porodica GBP (GBP1, GBP2 i GBP5) ima vitalnu ulogu u aktiviranju kanonskog i nekanonskog inflamasoma na odgovor na infekciju patogenom putem Chlamydia muridarum.[13]

Lokalizacija[uredi | uredi izvor]

Gen GBP2 nalazi se u različitim odjeljcima u ćeliji: jedro, citosol i citoskelet, a također se dimer GBP2-GBP5 nalazi u Golgijevom aparatu.[14]

Osim toga, za regulaciju unutarćelijske lokalizacije i membranske asocijacije GBP2 potrebna je i izoprenilacija.[15]

Aktivacija[uredi | uredi izvor]

Mišji gen GBP2 nije samo visoko aktiviran interferon-gama tokom aktivacije makrofaga, već i stimulacijom Tol-likih receptore, faktora nekroze tumora (TNF) i interleukina-1 beta.[16]

Ekspresija[uredi | uredi izvor]

Nakon stimulacije interferonom gama, mišji GPB2 eksprimira se u urođenim i prilagodljivim imunskim ćelijama.[12]

Interakcija[uredi | uredi izvor]

Gen GBP2 može komunicirati sa RNK, preko domena RRM1 i RRM2. RRM2 domen može prepoznati osnovni motiv GGUC prisutan u RNK. Osim toga, identificiran je novi tip RRM domena koji može komunicirati sa kompleksom THO/TREX.[17]

Gen GBp2 može surađivati sa TREX (transkripcija-eksport) kompleksom; multimerni kompleks ima različite transkripcijske i eksportne faktore kao što su Yra1 i Sub2.[17]

Klinički značaj[uredi | uredi izvor]

Genska mutacija[uredi | uredi izvor]

Kod pacijenata s migrenom identificirana je misens mutacija GBP2 (A907G). U prvom koraku može dovesti do vazomotorne disfunkcije, a zatim do glavobolje.[11]

Rak dojke[uredi | uredi izvor]

GBP2 se smatra kontrolnim faktorom za proliferaciju i širenje u tumorskoj ćeliji. Visoka ekspresija GBP2 povezana je s boljom dijagnozom raka dojke. P53 može regulirati GBP2 i imati esencijalnu ulogu u razvoju tumora, inhibicijom metaloproteinaze MM9 kao i NF-Kappa B i proteina Rac.[18]

Nivo transkripcije GBP2 također je reguliran i putem dva faktora transkripcije STAT1 i IRF1. Ekspresija GBP2 ima jaku korelaciju sa metagenom T-ćelija što se čini povezanom sa infiltracijom T-ćelija u rak dojke.[18]

Međutim, nedavna studija je pokazala da GBP2 može regulirati protein 1 (Drp1) povezan s dinaminom, kako bi blokirao translokaciju Drp1 u mitohondrije, što dovodi do slabljenja Drp1 ovisne mitohondrijske fisije i također invazija ćelija raka dojke.[19]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000162645 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000028270 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Cheng YS, Patterson CE, Staeheli P (September 1991). "Interferon-induced guanylate-binding proteins lack an N(T)KXD consensus motif and bind GMP in addition to GDP and GTP". Molecular and Cellular Biology. 11 (9): 4717–25. doi:10.1128/mcb.11.9.4717. PMC 361367. PMID 1715024.
  6. ^ a b "Entrez Gene: GBP2 guanylate binding protein 2, interferon-inducible".
  7. ^ Kim BH, Shenoy AR, Kumar P, Bradfield CJ, MacMicking JD (October 2012). "IFN-inducible GTPases in host cell defense". Cell Host & Microbe. 12 (4): 432–44. doi:10.1016/j.chom.2012.09.007. PMC 349020. PMID 23084913.
  8. ^ "UniProt, P32456" (jezik: eng.). Pristupljeno 2021-11-28. CS1 održavanje: nepreporučeni parametar (link) CS1 održavanje: nepoznati jezik (link)
  9. ^ Windgassen M, Krebber H (March 2003). "Identification of Gbp2 as a novel poly(A)+ RNA-binding protein involved in the cytoplasmic delivery of messenger RNAs in yeast". EMBO Reports. 4 (3): 278–83. doi:10.1038/sj.embor.embor763. PMC 1315891. PMID 12634846.
  10. ^ Ma G, Huang J, Sun N, Liu X, Zhu M, Wu Z, Zhao S (May 2008). "Molecular characterization of the porcine GBP1 and GBP2 genes". Molecular Immunology. 45 (10): 2797–807. doi:10.1016/j.molimm.2008.02.007. PMID 18346789.
  11. ^ a b Jiang, Yue (January 2016). "Six novel rare non-synonymous mutations for migraine without aura identified by exome sequencing". Journal of Neurogenetics. 29 (4): 188–194. doi:10.3109/01677063.2015.1122787. PMID 26814133. S2CID 207441191.
  12. ^ a b Praefcke GJ (November 2017). "Regulation of innate immune functions by guanylate-binding proteins". International Journal of Medical Microbiology. 308 (1): 237–245. doi:10.1016/j.ijmm.2017.10.013. PMID 29174633.
  13. ^ Man SM, Place DE, Kuriakose T, Kanneganti TD (January 2017). "Interferon-inducible guanylate-binding proteins at the interface of cell-autonomous immunity and inflammasome activation". Journal of Leukocyte Biology. 101 (1): 143–150. doi:10.1189/jlb.4MR0516-223R. PMC 6608036. PMID 27418355.
  14. ^ "GBP2 Gene". GeneCards Human Gene Database. Pristupljeno 2018-11-07.
  15. ^ Britzen-Laurent N, Bauer M, Berton V, Fischer N, Syguda A, Reipschläger S, Naschberger E, Herrmann C, Stürzl M (December 2010). "Intracellular trafficking of guanylate-binding proteins is regulated by heterodimerization in a hierarchical manner". PLOS ONE. 5 (12): e14246. Bibcode:2010PLoSO...514246B. doi:10.1371/journal.pone.0014246. PMC 2998424. PMID 21151871.
  16. ^ Degrandi D, Kravets E, Konermann C, Beuter-Gunia C, Klümpers V, Lahme S, Wischmann E, Mausberg AK, Beer-Hammer S, Pfeffer K (January 2013). "Murine guanylate binding protein 2 (mGBP2) controls Toxoplasma gondii replication". Proceedings of the National Academy of Sciences of the United States of America. 110 (1): 294–9. Bibcode:2013PNAS..110..294D. doi:10.1073/pnas.1205635110. PMC 3538222. PMID 23248289.
  17. ^ a b Martínez-Lumbreras S, Taverniti V, Zorrilla S, Séraphin B, Pérez-Cañadillas JM (January 2016). "Gbp2 interacts with THO/TREX through a novel type of RRM domain". Nucleic Acids Research. 44 (1): 437–48. doi:10.1093/nar/gkv1303. PMC 4705658. PMID 26602689.
  18. ^ a b Godoy P, Cadenas C, Hellwig B, Marchan R, Stewart J, Reif R, Lohr M, Gehrmann M, Rahnenführer J, Schmidt M, Hengstler JG (July 2014). "Interferon-inducible guanylate binding protein (GBP2) is associated with better prognosis in breast cancer and indicates an efficient T cell response". Breast Cancer. 21 (4): 491–9. doi:10.1007/s12282-012-0404-8. PMID 23001506. S2CID 8338232.
  19. ^ Zhang J, Zhang Y, Wu W, Wang F, Liu X, Shui G, Nie C (October 2017). "Guanylate-binding protein 2 regulates Drp1-mediated mitochondrial fission to suppress breast cancer cell invasion". Cell Death & Disease. 8 (10): e3151. doi:10.1038/cddis.2017.559. PMC 5680924. PMID 29072687.

Dopunska literatura[uredi | uredi izvor]