STX4

S Wikipedije, slobodne enciklopedije
STX4
Identifikatori
AliasiSTX4
Vanjski ID-jeviOMIM: 186591 MGI: 893577 HomoloGene: 105435 GeneCards: STX4
Lokacija gena (čovjek)
Hromosom 16 (čovjek)
Hrom.Hromosom 16 (čovjek)[1]
Hromosom 16 (čovjek)
Genomska lokacija za STX4
Genomska lokacija za STX4
Bend16p11.2Početak31,032,889 bp[1]
Kraj31,042,975 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za STX4
Genomska lokacija za STX4
Bend7|7 F3Početak127,423,466 bp[2]
Kraj127,448,191 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija SNAP receptor activity
GO:0001948, GO:0016582 vezivanje za proteine
sphingomyelin phosphodiesterase activator activity
SNARE binding
Ćelijska komponenta citoplazma
integral component of membrane
citosol
endozom
membrana
Sinapsna vezikula
ćelijska membrana
myelin sheath adaxonal region
dendritična kičma
sinapsa
intracellular anatomical structure
cell surface
Vakuola
trans-Golđijeva mreža
basolateral plasma membrane
somatodendritic compartment
specific granule
lateral loop
perinuklearno područje citoplazme
storage vacuole
Egzosom
lamellipodium
SNARE complex
Vanćelijsko
phagocytic vesicle membrane
Endomembranski sistem
presynaptic membrane
phagocytic vesicle
presynaptic active zone membrane
postsynapse
glutamatergic synapse
Biološki proces positive regulation of eosinophil degranulation
positive regulation of cell migration
organelle fusion
synaptic vesicle fusion to presynaptic active zone membrane
response to hydroperoxide
GO:0048554 positive regulation of catalytic activity
post-Golgi vesicle-mediated transport
regulation of exocytosis
vesicle docking
positive regulation of protein localization to plasma membrane
positive regulation of chemotaxis
positive regulation of cell population proliferation
positive regulation of protein localization to cell surface
regulation of extrinsic apoptotic signaling pathway via death domain receptors
positive regulation of insulin secretion involved in cellular response to glucose stimulus
intracellular protein transport
neurotransmitter transport
vesicle-mediated transport
SNARE complex assembly
positive regulation of cell adhesion
long-term potentiation
vesicle fusion with endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membrane
GO:0015915 transport
Egzocitoza
Fuzija vezikula
cytokine-mediated signaling pathway
cellular response to interferon-gamma
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001272095
NM_001272096
NM_004604

NM_009294

RefSeq (bjelančevina)

NP_001259024
NP_001259025
NP_004595

NP_033320

Lokacija (UCSC)Chr 16: 31.03 – 31.04 MbChr 7: 127.42 – 127.45 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Sintaksin-4 jest protein koji je kod ljudi kodiran genom STX4 sa hromosoma 16.[5][6][7]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 297 aminokiselina, a molekulska težina 34.180 Da.[5]

1020304050
MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQ
TIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQ
LKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE
KNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQAL
NEISARHSEIQQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSAD
YVERGQEHVKTALENQKKARKKKVLIAICVSITVVLLAVIIGVTVVG

Interakcije[uredi | uredi izvor]

Pokazalo se da je STX4 u interakciji sa:

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000103496 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000030805 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b Li H, Hodge DR, Pei GK, Seth A (Jun 1994). "Isolation and sequence analysis of the human syntaxin-encoding gene". Gene. 143 (2): 303–4. doi:10.1016/0378-1119(94)90117-1. PMID 8206394.
  6. ^ Low SH, Vasanji A, Nanduri J, He M, Sharma N, Koo M, Drazba J, Weimbs T (Feb 2006). "Syntaxins 3 and 4 are concentrated in separate clusters on the plasma membrane before the establishment of cell polarity". Molecular Biology of the Cell. 17 (2): 977–89. doi:10.1091/mbc.E05-05-0462. PMC 1356605. PMID 16339081.
  7. ^ "Entrez Gene: STX4 Syntaxin 4".
  8. ^ Kalwat MA, Wiseman DA, Luo W, Wang Z, Thurmond DC (January 2012). "Gelsolin associates with the N terminus of syntaxin 4 to regulate insulin granule exocytosis". Molecular Endocrinology. Baltimore, Md. 26 (1): 128–41. doi:10.1210/me.2011-1112. PMC 3248323. PMID 22108804.
  9. ^ a b Rual JF, Venkatesan K, Hao T, Hirozane-Kishikawa T, Dricot A, Li N, Berriz GF, Gibbons FD, Dreze M, Ayivi-Guedehoussou N, Klitgord N, Simon C, Boxem M, Milstein S, Rosenberg J, Goldberg DS, Zhang LV, Wong SL, Franklin G, Li S, Albala JS, Lim J, Fraughton C, Llamosas E, Cevik S, Bex C, Lamesch P, Sikorski RS, Vandenhaute J, Zoghbi HY, Smolyar A, Bosak S, Sequerra R, Doucette-Stamm L, Cusick ME, Hill DE, Roth FP, Vidal M (Oct 2005). "Towards a proteome-scale map of the human protein-protein interaction network". Nature. 437 (7062): 1173–8. doi:10.1038/nature04209. PMID 16189514. S2CID 4427026.
  10. ^ Li L, Omata W, Kojima I, Shibata H (Feb 2001). "Direct interaction of Rab4 with syntaxin 4". The Journal of Biological Chemistry. 276 (7): 5265–73. doi:10.1074/jbc.M003883200. PMID 11063739.
  11. ^ a b Hata Y, Südhof TC (Jun 1995). "A novel ubiquitous form of Munc-18 interacts with multiple syntaxins. Use of the yeast two-hybrid system to study interactions between proteins involved in membrane traffic". The Journal of Biological Chemistry. 270 (22): 13022–8. doi:10.1074/jbc.270.22.13022. PMID 7768895.
  12. ^ a b Ravichandran V, Chawla A, Roche PA (Jun 1996). "Identification of a novel syntaxin- and synaptobrevin/VAMP-binding protein, SNAP-23, expressed in non-neuronal tissues". The Journal of Biological Chemistry. 271 (23): 13300–3. doi:10.1074/jbc.271.23.13300. PMID 8663154.
  13. ^ a b Reed GL, Houng AK, Fitzgerald ML (Apr 1999). "Human platelets contain SNARE proteins and a Sec1p homologue that interacts with syntaxin 4 and is phosphorylated after thrombin activation: implications for platelet secretion". Blood. 93 (8): 2617–26. doi:10.1182/blood.V93.8.2617. PMID 10194441.
  14. ^ a b Steegmaier M, Yang B, Yoo JS, Huang B, Shen M, Yu S, Luo Y, Scheller RH (Dec 1998). "Three novel proteins of the syntaxin/SNAP-25 family". The Journal of Biological Chemistry. 273 (51): 34171–9. doi:10.1074/jbc.273.51.34171. PMID 9852078.
  15. ^ a b Imai A, Nashida T, Yoshie S, Shimomura H (Aug 2003). "Intracellular localisation of SNARE proteins in rat parotid acinar cells: SNARE complexes on the apical plasma membrane". Archives of Oral Biology. 48 (8): 597–604. doi:10.1016/s0003-9969(03)00116-x. PMID 12828989.
  16. ^ Li G, Alexander EA, Schwartz JH (May 2003). "Syntaxin isoform specificity in the regulation of renal H+-ATPase exocytosis". The Journal of Biological Chemistry. 278 (22): 19791–7. doi:10.1074/jbc.M212250200. PMID 12651853.
  17. ^ Araki S, Tamori Y, Kawanishi M, Shinoda H, Masugi J, Mori H, Niki T, Okazawa H, Kubota T, Kasuga M (May 1997). "Inhibition of the binding of SNAP-23 to syntaxin 4 by Munc18c". Biochemical and Biophysical Research Communications. 234 (1): 257–62. doi:10.1006/bbrc.1997.6560. PMID 9168999.
  18. ^ a b c d Paumet F, Le Mao J, Martin S, Galli T, David B, Blank U, Roa M (Jun 2000). "Soluble NSF attachment protein receptors (SNAREs) in RBL-2H3 mast cells: functional role of syntaxin 4 in exocytosis and identification of a vesicle-associated membrane protein 8-containing secretory compartment". Journal of Immunology. 164 (11): 5850–7. doi:10.4049/jimmunol.164.11.5850. PMID 10820264.
  19. ^ Kawanishi M, Tamori Y, Okazawa H, Araki S, Shinoda H, Kasuga M (Mar 2000). "Role of SNAP23 in insulin-induced translocation of GLUT4 in 3T3-L1 adipocytes. Mediation of complex formation between syntaxin4 and VAMP2". The Journal of Biological Chemistry. 275 (11): 8240–7. doi:10.1074/jbc.275.11.8240. PMID 10713150.
  20. ^ Freedman SJ, Song HK, Xu Y, Sun ZY, Eck MJ (Apr 2003). "Homotetrameric structure of the SNAP-23 N-terminal coiled-coil domain". The Journal of Biological Chemistry. 278 (15): 13462–7. doi:10.1074/jbc.M210483200. PMID 12556468.
  21. ^ a b Schraw TD, Lemons PP, Dean WL, Whiteheart SW (Aug 2003). "A role for Sec1/Munc18 proteins in platelet exocytosis". The Biochemical Journal. 374 (Pt 1): 207–17. doi:10.1042/BJ20030610. PMC 1223584. PMID 12773094.
  22. ^ a b Widberg CH, Bryant NJ, Girotti M, Rea S, James DE (Sep 2003). "Tomosyn interacts with the t-SNAREs syntaxin4 and SNAP23 and plays a role in insulin-stimulated GLUT4 translocation". The Journal of Biological Chemistry. 278 (37): 35093–101. doi:10.1074/jbc.M304261200. PMID 12832401.
  23. ^ Nogami S, Satoh S, Tanaka-Nakadate S, Yoshida K, Nakano M, Terano A, Shirataki H (Jul 2004). "Identification and characterization of taxilin isoforms". Biochemical and Biophysical Research Communications. 319 (3): 936–43. doi:10.1016/j.bbrc.2004.05.073. PMID 15184072.
  24. ^ Mollinedo F, Martín-Martín B, Calafat J, Nabokina SM, Lazo PA (Jan 2003). "Role of vesicle-associated membrane protein-2, through Q-soluble N-ethylmaleimide-sensitive factor attachment protein receptor/R-soluble N-ethylmaleimide-sensitive factor attachment protein receptor interaction, in the exocytosis of specific and tertiary granules of human neutrophils". Journal of Immunology. 170 (2): 1034–42. doi:10.4049/jimmunol.170.2.1034. PMID 12517971.
  25. ^ Jagadish MN, Fernandez CS, Hewish DR, Macaulay SL, Gough KH, Grusovin J, Verkuylen A, Cosgrove L, Alafaci A, Frenkel MJ, Ward CW (Aug 1996). "Insulin-responsive tissues contain the core complex protein SNAP-25 (synaptosomal-associated protein 25) A and B isoforms in addition to syntaxin 4 and synaptobrevins 1 and 2". The Biochemical Journal. 317 (3): 945–54. doi:10.1042/bj3170945. PMC 1217577. PMID 8760387.
  26. ^ a b Polgár J, Chung SH, Reed GL (Aug 2002). "Vesicle-associated membrane protein 3 (VAMP-3) and VAMP-8 are present in human platelets and are required for granule secretion". Blood. 100 (3): 1081–3. doi:10.1182/blood.v100.3.1081. PMID 12130530.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]