DZIP1

S Wikipedije, slobodne enciklopedije
DZIP1
Identifikatori
AliasiDZIP1
Vanjski ID-jeviOMIM: 608671 MGI: 1914311 HomoloGene: 45708 GeneCards: DZIP1
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za DZIP1
Genomska lokacija za DZIP1
Bend13q32.1Početak95,578,202 bp[1]
Kraj95,644,706 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za DZIP1
Genomska lokacija za DZIP1
Bend14|14 E4Početak118,875,520 bp[2]
Kraj118,925,460 bp[2]
Obrazac RNK ekspresije
PBB GE DZIP1 204557 s at fs.png

PBB GE DZIP1 204556 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 protein binding
metal ion binding
nucleic acid binding
Ćelijska komponenta citoplazma
ciliary basal body
ciliary transition fiber
Centriole
projekcija ćelije
Treplja
citoskelet
Jedro
Nukleoplazma
centar organizacije mikrotubula
citosol
GO:0009327 protein-containing complex
centriolar satellite
Biološki proces multicellular organism development
establishment of protein localization
germ cell development
smoothened signaling pathway
Ćelijska diferencijacija
Spermatogeneza
cytoplasmic sequestering of protein
cilium assembly
regulation of protein binding
cilium organization
positive regulation of cilium assembly
protein localization to cilium
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_014934
NM_198968

NM_025943
NM_001360411
NM_001360412
NM_001360413

RefSeq (bjelančevina)

NP_055749
NP_945319

NP_080219
NP_001347340
NP_001347341
NP_001347342

Lokacija (UCSC)Chr 13: 95.58 – 95.64 MbChr 14: 118.88 – 118.93 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Protein DZIP1 cinkovog prsta je protein koji je kod ljudi kodiran genom DZIP1, sa hromosoma 13.[5] Analizom genomske sekvence, Christian et al. (2002) mapirali su gen DZIP1 na hromosomskoj regiji 13q32-q33. Moore et al. (2004) locirali su DZIP1 na hromosomu 13, sekvenca 13q31.[6][7]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 867 aminokiselina, a molekulska težina 98-664 Da.[8]

1020304050
MQAEAADWFSSMPFQKHVYYPLASGPEGPDVAVAAAAAGAASMACAPPSA
ASGPLPFFQFRPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCK
LEDEKCPHCQSGVDPVLLKLIRLAQFTIEYLLHSQEFLTSQLHTLEERLR
LSHCDGEQSKKLLTKQAGEIKTLKEECKRRKKMISTQQLMIEAKANYYQC
HFCDKAFMNQAFLQSHIQRRHTEENSHFEYQKNAQIEKLRSEIVVLKEEL
QLTRSELEAAHHASAVRFSKEYEMQKTKEEDFLKLFDRWKEEEKEKLVDE
MEKVKEMFMKEFKELTSKNSALEYQLSEIQKSNMQIKSNIGTLKDAHEFK
EDRSPYPQDFHNVMQLLDSQESKWTARVQAIHQEHKKEKGRLLSHIEKLR
TSMIDDLNASNVFYKKRIEELGQRLQEQNELIITQRQQIKDFTCNPLNSI
SEPKGNPLAWQAFESQPAAPAVPMNAPALHTLETKSSLPMVHEQAFSSHI
LEPIEELSEEEKGRENEQKLNNNKMHLRKALKSNSSLTKGLRTMVEQNLM
EKLETLGINADIRGISSDQLHRVLKSVESERHKQEREIPNFHQIREFLEH
QVSCKIEEKALLSSDQCSVSQMDTLSTGEVPKMIQLPSKNRQLIRQKAVS
TDRTSVPKIKKNVMEDPFPRKSSTITTPPFSSEEEQEDDDLIRAYASPGP
LPVPPPQNKGSFGKNTVKSDADGTEGSEIEDTDDSPKPAGVAVKTPTEKV
EKMFPHRKNVNKPVGGTNVPEMFIKKEELQELKCADVEDEDWDISSLEEE
ISLGKKSGKEQKEPPPAKNEPHFAHVLNAWGAFNPKGPKGEGLQENESST
LKSSLVTVTDWSDTSDV
Simboli

Kloniranje i ekspresija[uredi | uredi izvor]

Sekvenciranjem klonova dobijenih iz biblioteke cDNK frakcionirane veličine mozga, Nagase et al. (1999) klonirali su DZIP1, koji su označili kao KIAA0996. Transkript sadrži ponavljajuće elemente u 5-prim i 3-prim UTR-ovima, a protein od 848 aminokiselina ima slabu homologiju sa mišjim receptorom za pokretljivost posredovanim hijaluronanom. RT-PCR ELISA testom otkrivena je sveprisutna ekspresija, s najvišim nivoima u mozgu, bubrezima, jajnicima, sjemenicima, plućima, gušterači, kičmenoj moždini i svim regijama mozga odraslih. Niža ekspresija otkrivena je u srcu, jetri, skeletnim mišićima, slezeni i fetusnom mozgu i jetri.[9]

Koristeći DAZ kaosondu u 2-hibridnom skriningu kvaščeve biblioteke cDNK testisa, Moore et al. (2004) klonirali su dvije varijante prerade DZIP1, koje su nazvali DZIPt1 i DZIPt2. Upućivali su na varijantu DZIP1, koju su klonirali iz mozga Nagase et al. (1999) kao DZIPb. Sve tri varijante kodiraju proteine sa domenom cinkovog prsta tipa C2H2. Izvedeni proteini DZIPt1 i DZIPt2 sadrže 277, odnosno 867 aminokiselina. DZIPt2 ima izračunatu molekulsku masu od 98 kD. Northern blot analiza otkrila je transkripte od oko 1,35, 2,4, 3,9 i 4,4 kb u sjemenicima. Ekspresija DZIP1 bila je najveća u testisima, sa znatno nižom ekspresijom u skeletnim mišićima i jajnicima. Kvantitativna PCR analiza otkrila je DZIP1 u fetusnom mozgu, jajnicima i sjemenicima, kao i u oocitima i testisima odraslih. DZIP1 je također eksprimiran u nediferenciranim embrionskim matičnim ćelijama. Ekspresija DZIPt1 nije otkrivena u testisima muškaraca sa sindromom samo Sertolijevih ćelija, kojima nedostaju zametne ćelije. Western blot analiza ljudskih testisa otkrila je proteine DZIP1 od oko 100 i 113 kD. Imunohistokemijska analiza presjeka fetusnih testisa lokalizirala je DZIP1 u jedru i citoplazmi primordijalnih zametnih ćelija, gdje se kolokalizirao s DAZ i DAZL. U testisima odraslih osoba, DZIP1 je lokaliziran u jedima spermatogonija, s nekim citoplazmatskim bojenjem. Protein DZIP1 nije otkriven u primarnim spermatocitima, ali jeste u zrelijim zametnim ćelijama, gdje je bio pretežno jedarni. Sličan obrazac bojenja pronađen je u embrionskim matičnim ćelijama miša i testisima odraslih.

Funkcija gena[uredi | uredi izvor]

Koimunoprecipitacijskim testovima, Moore et al. (2004) utvrdili su da DAZ može formirati stabilne komplekse sa DZIPt1 ili DZIPt2. Analiza domena pokazala je da regija C2H2 cinkovog prsta DZIPt1 može stupiti u interakciju s više od jednog područja DAZ -a.

Molekulska genetika[uredi | uredi izvor]

Prolaps mitralnog zaliska 3

U velikoj porodici od četiri generacije s prolapsom mitralne valvule, mapiranjem na homosomu 23, sekvenca q31.3-q32.1 (MVP3), Toomer et al. (2019) identificirali su heterozigotnost za misens mutaciju u genu DZIP1, koja se potpuno odvojila od bolesti. Autori su označili promjenu S24R. odnosno S70R u dvije poznate izoforme DZIP1. Na osnovu ove porodice, kao i njihovih analiza listića mitralne valvule čoveka i modela miša, zaključili su da defekti cilija mogu uzrokovati miksomatoznu bolest mitralne valvule kod ljudi.

Spermatogeni defekt 47

U dva nepovezana Han kineska muškarca s neplodnošću zbog odsutne ili kratka spermatozoidna biča (SPGF47), Lv et al (2020) identificirali su homozigotnost za mutacije u DZIP1 genu: nonsens (Y230X) i misens mutacija (R63Q).

Životinjski model[uredi | uredi izvor]

Prolaps mitralnog zaliska

Koristeći CRISPR-Cas9, Toomer et al. (2019) generirali su miševe sa mutacijom S14R u Dzip1 genu, što odgovara S24R DZIP1 mutaciji čovjeka. Odrasli miševi heterozigotni za varijantu S14R razvili su miksomatozne mitralne zaliske i funkcionalni prolaps mitralne zaliska (MVP). Histološka analiza pri rođenju, otkrila je da su svi heterozigotni miševi imali fenotip mitralnog zaliska promjenjive težine, koji je u korelaciji sa smanjenjem dužine cilija. Genske ontološke analize na embrionskoj (E) dobi od 13,5 dana pokazale su da su najznačajnije promjene u srcima mutanata u odnosu na kontrole bile one koje su povezane s putevima vanćelijskog matriksa (ECM); autori su sugerirali da ove promjene u sastavu ECM -a na E13,5 vjerovatno predstavljaju rane promjene u molekulskom profilu srca u razvoju. Genetičko uklanjanje Dzip1 iz progenitornih ćelija mezenhimskog zaliska rezultiralo je smanjenjem dužine primarnih cilija tokom razvoja i popratnim anatomskim promjenama u mitralnim zaliscima, slično onima koje su primijećene kod miševa mutanata S14R. Mitralni zalisci miševa sa uslovnim nokautom Dzip1 pokazali su miksomatozni fenotip, sa povećanjem proteoglikana i kolagena i gubitkom normalnih ECM zonskih granica u odnosu na kontrolne mitralne zaliske. Funkcionalna ehokardiografija otkrila je prolaps i produženje zalistaka kod miševa s nedostatkom Dzip1; MVP nikada nije primijećen kod kontrolnih miševa. Autori su zaključili da rijetke štetne mutacije DZIP1 mogu uzrokovati MVP mijenjanjem ciliogenih programa tokom razvoja.[10]

Spermatogeni defekt

Lv et al. (2020) generirali su mužjake nokautiranih Dzip1 miševa, koji su svi bili neplodni. Nekoliko spermatozoida prikupljeno je iz epididimisa mutiranih miševa, a nisu uočeni pokretni spermatozoidi. Svjetlosna mikroskopija mutiranih spermatozoida pokazala je ozbiljne morfološke abnormalnosti, prvenstveno odsutne flagele, kao i zaostalu citoplazmu i abnormalne glave.[11]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000134874 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000042156 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: DZIP1 DAZ interacting protein 1". CS1 održavanje: nepreporučeni parametar (link)
  6. ^ Christian, S. L., McDonough, J., Liu, C., Shaikh, S., Vlamakis, V., Badner, J. A., Chakravarti, A., Gershon, E. S. An evaluation of the assembly of an approximately 15-Mb region on human chromosome 13q32-q33 linked to bipolar disorder and schizophrenia. Genomics 79: 635-656, 2002. PubMed: 11991713
  7. ^ Moore, F. L., Jaruzelska, J., Dorfman, D. M., Reijo-Pera, R. A. Identification of a novel gene, DZIP (DAZ-interacting protein), that encodes a protein that interacts with DAZ (deleted in azoospermia) and is expressed in embryonic stem cells and germ cells. Genomics 83: 834-843, 2004. [PubMed: 15081113
  8. ^ "UniProt, Q86YF9". Pristupljeno 2017-09-11. CS1 održavanje: nepreporučeni parametar (link)
  9. ^ Nagase, T., Ishikawa, K., Suyama, M., Kikuno, R., Hirosawa, M., Miyajima, N., Tanaka, A., Kotani, H., Nomura, N., Ohara, O. Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 6: 63-70, 1999. PubMed: 10231032
  10. ^ Toomer, K. A., Yu, M., Fulmer, D., Guo, L., Moore, K. S., Moore, R., Drayton, K. D., Glover, J., Peterson, N., Ramos-Ortiz, S., Drohan, A., Catching, B. J., and 32 others. Primary cilia defects causing mitral valve prolapse. Sci. Transl. Med. 11: eaax0290, 2019. Note: Electronic Article. PubMed: 31118289
  11. ^ Lv, M., Liu, W., Chi, W., Ni, X., Wang, J., Cheng, H., Li, W.-Y., Yang, S., Wu, H., Zhang, J., Gao, Y., Liu, C., and 19 others. Homozygous mutations in DZIP1 can induce asthenoteratospermia with severe MMAF. J. Med. Genet. 57: 445-453, 2020. [PubMed: 32051257

Dopunska literatura[uredi | uredi izvor]