Idi na sadržaj

ARNT

S Wikipedije, slobodne enciklopedije
ARNT
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4PKY, 1X0O, 2A24, 2B02, 2HV1, 2K7S, 3F1N, 3F1O, 3F1P, 3H7W, 3H82, 4EQ1, 4GHI, 4GS9, 4H6J, 4LPZ, 4XT2

Identifikatori
AliasiARNT
Vanjski ID-jeviOMIM: 126110 MGI: 88071 HomoloGene: 1261 GeneCards: ARNT
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za ARNT
Genomska lokacija za ARNT
Bend1q21.3Početak150,809,713 bp[1]
Kraj150,876,708 bp[1]
Lokacija gena (miš)
Hromosom 3 (miš)
Hrom.Hromosom 3 (miš)[2]
Hromosom 3 (miš)
Genomska lokacija za ARNT
Genomska lokacija za ARNT
Bend3 F2.1|3 40.74 cMPočetak95,341,699 bp[2]
Kraj95,404,551 bp[2]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija sequence-specific DNA binding
vezivanje sa DNK
protein dimerization activity
GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
GO:0001105 transcription coactivator activity
aryl hydrocarbon receptor binding
transcription factor binding
GO:0001948, GO:0016582 vezivanje za proteine
protein heterodimerization activity
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
protein homodimerization activity
sequence-specific double-stranded DNA binding
GO:0038050, GO:0004886, GO:0038051 nuclear receptor activity
Ćelijska komponenta citoplazma
transcription regulator complex
nukleoplazma
RNA polymerase II transcription regulator complex
jedro
nuclear body
Biološki proces positive regulation of vascular endothelial growth factor receptor signaling pathway
Ćelijska diferencijacija
response to hypoxia
GO:0009373 regulation of transcription, DNA-templated
positive regulation of endothelial cell proliferation
regulation of transcription from RNA polymerase II promoter in response to oxidative stress
positive regulation of erythrocyte differentiation
embryonic placenta development
mRNA transcription by RNA polymerase II
positive regulation of protein sumoylation
transcription, DNA-templated
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
intracellular receptor signaling pathway
regulation of transcription from RNA polymerase II promoter in response to hypoxia
positive regulation of vascular endothelial growth factor production
positive regulation of glycolytic process
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
positive regulation of hormone biosynthetic process
xenobiotic metabolic process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_001197325
NM_001286035
NM_001286036
NM_001668
NM_178426

NM_178427
NM_001350224
NM_001350225
NM_001350226

NM_001037737
NM_009709

RefSeq (bjelančevina)
NP_001184254
NP_001272964
NP_001272965
NP_001659
NP_848514

NP_001337153
NP_001337154
NP_001337155

NP_001032826
NP_033839

Lokacija (UCSC)Chr 1: 150.81 – 150.88 MbChr 3: 95.34 – 95.4 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

ARNT (skr. punog naziva na engleskom: jedarni translokator receptora aril-ugljovodonika) jest gen koji se kod ljudi nalazi na hromosomu 1. Kodira jedarni translokator receptora aril ugljovodonika, protein koji formira kompleks sa za ligand vezanim aril ugljikovodični receptor (AhR), a potreban je za funkciju receptora.

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 789 aminokiselina, a molekulska težina 86.636 Da.[5]

1020304050
MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFD
DDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERR
RRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTST
DGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQP
QSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQ
SSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPN
CTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFC
HPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPY
SDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANLPLEMGSGQLA
PRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFA
QDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQ
QVATQATAKTRTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNR
GSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPA
QQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE

Funkcija

[uredi | uredi izvor]

Kodirani protein je takođe identifikovan kao beta podjedinica heterodimernog transkripcijskog faktora, hipoksija-inducibilni faktor 1 (HIF1). Translokacija t(1;12)(q21;p13), koja rezultira fuzijom proteina TEL-ARNT, povezana je sa akutnom mijeloblastnom leukemijom. Za ovaj gen su opisane tri alternativno prerađene varijante transkripta koje kodiraju različite izoforme.

Aril-hidrokarbonski receptor (AhR) uključen je u indukciju nekoliko enzima koji učestvuju u ksenobiotskom metabolizmu. Citosolni oblik aril-ugljokovodikovog receptora bez liganda složen je u protein toplotnog šoka 90. Vezivanje liganda, koji uključuje dioksin i policiklični aromatski ugljikovodik, rezultira translokacijom podjedinice koja vezuje ligand samo u[6] jedru. Indukcija enzima uključenih u metabolizam ksenobiotika događa se vezivanjem AhR vezanog za ligand elemenata koji reaguju na ksenobiotike u promotorima gena za ove enzime.

Interakcije

[uredi | uredi izvor]

Pokazalo se da jedarni translokator receptora aril-ugljikovodika reaguje sa:

Reference

[uredi | uredi izvor]
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000143437 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000015522 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "UniProt, P27540" (jezik: en.). Pristupljeno 7. 12. 2021.CS1 održavanje: nepoznati jezik (link)
  6. ^ Hughes, D.; Guttenplan, J. B.; Marcus, C. B.; Subbaramaiah, K.; Dannenberg, A. J. (2008). "Heat Shock Protein 90 Inhibitors Suppress Aryl Hydrocarbon Receptor-Mediated Activation of CYP1A1 and CYP1B1 Transcription and DNA Adduct Formation". Cancer Prevention Research. 1 (6): 485–493. doi:10.1158/1940-6207.CAPR-08-0149. PMC 2680610. PMID 19138996.
  7. ^ Carver LA, Bradfield CA (april 1997). "Ligand-dependent interaction of the aryl hydrocarbon receptor with a novel immunophilin homolog in vivo". J. Biol. Chem. 272 (17): 11452–6. doi:10.1074/jbc.272.17.11452. PMID 9111057.
  8. ^ Kazlauskas A, Sundström S, Poellinger L, Pongratz I (april 2001). "The hsp90 chaperone complex regulates intracellular localization of the dioxin receptor". Mol. Cell. Biol. 21 (7): 2594–607. doi:10.1128/MCB.21.7.2594-2607.2001. PMC 86890. PMID 11259606.
  9. ^ Lindebro MC, Poellinger L, Whitelaw ML (juli 1995). "Protein-protein interaction via PAS domains: role of the PAS domain in positive and negative regulation of the bHLH/PAS dioxin receptor-Arnt transcription factor complex". EMBO J. 14 (14): 3528–39. doi:10.1002/j.1460-2075.1995.tb07359.x. PMC 394421. PMID 7628454.
  10. ^ Whitelaw M, Pongratz I, Wilhelmsson A, Gustafsson JA, Poellinger L (april 1993). "Ligand-dependent recruitment of the Arnt coregulator determines DNA recognition by the dioxin receptor". Mol. Cell. Biol. 13 (4): 2504–14. doi:10.1128/MCB.13.4.2504. PMC 359572. PMID 8384309.
  11. ^ Yamaguchi Y, Kuo MT (oktobar 1995). "Functional analysis of aryl hydrocarbon receptor nuclear translocator interactions with aryl hydrocarbon receptor in the yeast two-hybrid system". Biochem. Pharmacol. 50 (8): 1295–302. doi:10.1016/0006-2952(95)02016-6. PMID 7488247.
  12. ^ Mimura J, Ema M, Sogawa K, Fujii-Kuriyama Y (januar 1999). "Identification of a novel mechanism of regulation of Ah (dioxin) receptor function". Genes Dev. 13 (1): 20–5. doi:10.1101/gad.13.1.20. PMC 316371. PMID 9887096.
  13. ^ a b Hogenesch JB, Chan WK, Jackiw VH, Brown RC, Gu YZ, Pray-Grant M, Perdew GH, Bradfield CA (mart 1997). "Characterization of a subset of the basic-helix-loop-helix-PAS superfamily that interacts with components of the dioxin signaling pathway". J. Biol. Chem. 272 (13): 8581–93. doi:10.1074/jbc.272.13.8581. PMID 9079689.
  14. ^ a b c Woods SL, Whitelaw ML (mart 2002). "Differential activities of murine single minded 1 (SIM1) and SIM2 on a hypoxic response element. Cross-talk between basic helix-loop-helix/per-Arnt-Sim homology transcription factors". J. Biol. Chem. 277 (12): 10236–43. doi:10.1074/jbc.M110752200. PMID 11782478.
  15. ^ Beischlag TV, Wang S, Rose DW, Torchia J, Reisz-Porszasz S, Muhammad K, Nelson WE, Probst MR, Rosenfeld MG, Hankinson O (juni 2002). "Recruitment of the NCoA/SRC-1/p160 family of transcriptional coactivators by the aryl hydrocarbon receptor/aryl hydrocarbon receptor nuclear translocator complex". Mol. Cell. Biol. 22 (12): 4319–33. doi:10.1128/mcb.22.12.4319-4333.2002. PMC 133867. PMID 12024042.
  16. ^ a b Probst MR, Fan CM, Tessier-Lavigne M, Hankinson O (februar 1997). "Two murine homologs of the Drosophila single-minded protein that interact with the mouse aryl hydrocarbon receptor nuclear translocator protein". J. Biol. Chem. 272 (7): 4451–7. doi:10.1074/jbc.272.7.4451. PMID 9020169.
  17. ^ Ooe N, Saito K, Mikami N, Nakatuka I, Kaneko H (januar 2004). "Identification of a novel basic helix-loop-helix-PAS factor, NXF, reveals a Sim2 competitive, positive regulatory role in dendritic-cytoskeleton modulator drebrin gene expression". Mol. Cell. Biol. 24 (2): 608–16. doi:10.1128/mcb.24.2.608-616.2004. PMC 343817. PMID 14701734.
  18. ^ Moffett P, Reece M, Pelletier J (septembar 1997). "The murine Sim-2 gene product inhibits transcription by active repression and functional interference". Mol. Cell. Biol. 17 (9): 4933–47. doi:10.1128/mcb.17.9.4933. PMC 232345. PMID 9271372.

Dopunska literatura

[uredi | uredi izvor]

Vanjski linkovi

[uredi | uredi izvor]

Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.