Idi na sadržaj

TMPRSS2

S Wikipedije, slobodne enciklopedije
TMPRSS2
Identifikatori
AliasiTMPRSS2
Vanjski ID-jeviOMIM: 602060 MGI: 1354381 HomoloGene: 4136 GeneCards: TMPRSS2
Lokacija gena (čovjek)
Hromosom 21 (čovjek)
Hrom.Hromosom 21 (čovjek)[1]
Hromosom 21 (čovjek)
Genomska lokacija za TMPRSS2
Genomska lokacija za TMPRSS2
Bend21q22.3Početak41,464,300 bp[1]
Kraj41,531,116 bp[1]
Lokacija gena (miš)
Hromosom 16 (miš)
Hrom.Hromosom 16 (miš)[2]
Hromosom 16 (miš)
Genomska lokacija za TMPRSS2
Genomska lokacija za TMPRSS2
Bend16 C4|16 57.53 cMPočetak97,365,882 bp[2]
Kraj97,412,395 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija scavenger receptor activity
GO:0070122 peptidase activity
serine-type peptidase activity
GO:0001948, GO:0016582 vezivanje za proteine
hydrolase activity
serine-type endopeptidase activity
Ćelijska komponenta integral component of membrane
extracellular region
ćelijska membrana
integral component of plasma membrane
Egzosom
membrana
Biološki proces positive regulation of viral entry into host cell
protein autoprocessing
receptor-mediated endocytosis
Proteoliza
vesicle-mediated transport
Endocitoza
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001135099
NM_005656
NM_001382720

NM_015775

RefSeq (bjelančevina)

NP_001128571
NP_005647
NP_001369649

NP_056590

Lokacija (UCSC)Chr 21: 41.46 – 41.53 MbChr 16: 97.37 – 97.41 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Serin 2 transmembranska proteaza jest enzim koji je kod ljudi kodiran genom TMPRSS2 sa hromosoma 21.[5][6][7]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 492 aminokiseline, a molekulska težina 53.859 Da.[6]

1020304050
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVP
QYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAAL
AAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVR
LYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGI
VDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNS
SRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK
PLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMK
LQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAA
KVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKN
NIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Funkcija gena TMPRSS2[uredi | uredi izvor]

Gen TMPRSS2 kodira protein koji pripada porodici serin-proteaza. Kodirani protein sadrži transmembranski tip II domen, domen klase receptora A, domen bogat cisteinom receptora za čišćenje i domen proteaze. Poznato je da su serinske proteaze uključene u mnoge fiziološke i patološke procese. Pokazalo se da je ovaj gen pojačano reguliran androgenim hormonima u ćelijama raka prostate i smanjeno u tkivu. kancera prostate nezavisnog od androgena Smatra se da se domen proteaze ovog proteina cijepa i izlučuje u ćelijski medij nakon autocijepanja.[6] TMPRSS2 učestvuje u proteolitskim kaskadama neophodnim za normalnu fiziološku funkciju prostate.[7] Nokaut-miševi kojima nedostaje gen TMPRSS2 ne pokazuje abnormalnosti.[8]

ERG genska fuzija[uredi | uredi izvor]

Funkcija proteina TMPRSS2 u karcinogenezi prostate oslanja se na prekomjernu ekspresiju transkripcijskog faktora ETS, kao što su ERG i ETV1, putem fuzije gena . TMPRSS2-ERG fuzioni gen je najčešći, prisutan u 40% – 80% karcinoma prostate kod ljudi. Prekomjerna ekspresija ERG-a doprinosi razvoju nezavisnosti od androgena kod raka prostate putem prekida signalizacije androgenih receptora.[9]

U korona virusima[uredi | uredi izvor]

Neki korona virusi, npr. sindrom koronavirusnog teškog akutnog respiratornog kovida (SARS-CoV-1), koronavirus Bliskoistočnog respiratornog sindroma (MERS-CoV) i koronavirus 2 teškog akutnog respiratornog sindroma (SARS-CoV-2) (prije omikron varijanta), aktiviraju se preko TMPRSS2 i stoga mogu biti spriječeni inhibitorima TMPRSS2.[10][11] SARS-CoV-2 uses the SARS-CoV receptor ACE2 for entry and the serine protease TMPRSS2 for S protein priming.[12]

Cepanje SARS-CoV-2 S2 bodljasti protein potrebnog za ulazak virusa u ćelije može se postići pomoću proteaza TMPRSS2 lociranih na ćelijskoj membrani ili pomoću katepsina (prvenstveno katepsina L) u endolizosomima.[13] Hidroksihloroikin inhibira djelovanje katepsina L u endolizosomima, ali budući da je cijepanje katepsina L neznatno u poređenju sa cijepanjem TMPRSS2, hidroksihlorokin čini malo da inhibira infekcije SARS-CoV-2.[13]

Enzim Adam17 ima sličnu aktivnost cijepanja ACE2 kao iTMPRSS2, ali formiranjem rastvorljivog ACE2, adam17 zapravo može imati zaštitni učinak blokiranja cirkulirajućih čestica virusa SARS-CoV-2.[14] Neoslobađanjem rastvorljivog ACE2, cijepanje TMPRSS2 je štetnije.[14]

Inhibitor TMPRSS2 kao što je camostat odobren za kliničku upotrebu blokirao je ulazak i mogao bi predstavljati opciju liječenja.[11][13] Još jedan eksperimentalni kandidat kao inhibitor TMPRSS2 za potencijalnu upotrebu protiv gripe i koronavirusnih infekcija općenito, uključujući i one prije pojave COVID-19, je OTC (u većini zemalja) mukolitski lijek protiv kašlja bromheksin,[15] koji se također istražuje kao mogući tretman i za sam COVID-19.[16] The fact that TMPRSS2 has no known irreplaceable function makes it a promising target for preventing SARS-CoV-2 virus transmission.[8]

Činjenica da je teška bolest i smrt od Sars-Cov-2 češća kod muškaraca nego kod žena, te da je TMPRSS2 nekoliko puta izraženiji u prostati epitelu nego u bilo kojem tkivu, sugerira ulogu TMPRSS2 u rodnoj razlici.[17][18] Pacijenti sa rakom prostate koji primaju terapiju deprivacije androgena imaju manji rizik od infekcije SARS-CoV-2 od onih koji ne primaju tu terapiju.[17][18]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000184012 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000000385 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Paoloni-Giacobino A, Chen H, Peitsch MC, Rossier C, Antonarakis SE (September 1997). "Cloning of the TMPRSS2 gene, which encodes a novel serine protease with transmembrane, LDLRA, and SRCR domains and maps to 21q22.3". Genomics. 44 (3): 309–20. doi:10.1006/geno.1997.4845. PMID 9325052.
  6. ^ a b c "Entrez Gene: TMPRSS2 transmembrane protease, serine 2".
  7. ^ a b "UniProt Protein: TMPS2_HUMAN transmembrane protease".
  8. ^ a b Sarker J, Das P, Sarker S, Roy AK, Momen A (2021). "A Review on Expression, Pathological Roles, and Inhibition of TMPRSS2, the Serine Protease Responsible for SARS-CoV-2 Spike Protein Activation". List of Hindawi academic journals. 2021: 2706789. doi:10.1155/2021/2706789. PMC 8313365 Provjerite vrijednost parametra |pmc= (pomoć). PMID 34336361 Provjerite vrijednost parametra |pmid= (pomoć).
  9. ^ Yu J, Yu J, Mani RS, Cao Q, Brenner CJ, Cao X, et al. (May 2010). "An integrated network of androgen receptor, polycomb, and TMPRSS2-ERG gene fusions in prostate cancer progression". Cancer Cell. 17 (5): 443–54. doi:10.1016/j.ccr.2010.03.018. PMC 2874722. PMID 20478527.
  10. ^ Huggins, DJ (November 2020). "Structural analysis of experimental drugs binding to the SARS-CoV-2 target TMPRSS2". Journal of Molecular Graphics and Modelling. 100: 107710. doi:10.1016/j.jmgm.2020.107710. PMC 7417922. PMID 32829149.
  11. ^ a b Hoffmann M, Kleine-Weber H, Schroeder S, Krüger N, Herrler T, Erichsen S, et al. (March 2020). "SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor". Cell. 181 (2): 271–280.e8. doi:10.1016/j.cell.2020.02.052. PMC 7102627. PMID 32142651. SažetakDeutsches Primatenzentrum GmbH.
  12. ^ Rahman N, Basharat Z, Yousuf M, Castaldo G, Rastrelli L, Khan H (May 2020). "Virtual screening of natural products against type II transmembrane serine protease (TMPRSS2), the priming agent of Coronavirus 2 (SARS-CoV-2)". Molecules. 25 (10): 2271. doi:10.3390/molecules25102271. PMC 7287752. PMID 32408547.
  13. ^ a b c Jackson CB, Farzan M, Chen B, Choe H (Oct 2021). "Mechanisms of SARS-CoV-2 entry into cells". Nature Reviews Molecular Cell Biology. 23 (1): 3–20. doi:10.1038/s41580-021-00418-x. PMC 8491763 Provjerite vrijednost parametra |pmc= (pomoć). PMID 34611326 Provjerite vrijednost parametra |pmid= (pomoć).
  14. ^ a b Zipeto D, Argañaraz GA, Argañaraz ER (2020). "ACE2/ADAM17/TMPRSS2 Interplay May Be the Main Risk Factor for COVID-19". Frontiers in Immunology. 11: 576745. doi:10.3389/fimmu.2020.576745. PMC 7575774. PMID 33117379.
  15. ^ Shen, Li Wen; Mao, Hui Juan; Wu, Yan Ling; Tanaka, Yoshimasa; Zhang, Wen (November 2017). "TMPRSS2: A potential target for treatment of influenza virus and coronavirus infections". Biochimie. 142: 1–10. doi:10.1016/j.biochi.2017.07.016. PMC 7116903. PMID 28778717.
  16. ^ Depfenhart, Markus; de Villiers, Danielle; Lemperle, Gottfried; Meyer, Markus; Di Somma, Salvatore (August 2020). "Potential new treatment strategies for COVID-19: is there a role for bromhexine as add-on therapy?". Internal and Emergency Medicine. 15 (5): 801–812. doi:10.1007/s11739-020-02383-3. PMC 7249615. PMID 32458206.
  17. ^ a b Mollica V, Rizzo A, Massari F (2020). "The pivotal role of TMPRSS2 in coronavirus disease 2019 and prostate cancer". Future Oncology. 16 (27): 2029–2033. doi:10.2217/fon-2020-0571. PMC 7359420. PMID 32658591.
  18. ^ a b Epstein RJ (2021). "The secret identities of TMPRSS2: Fertility factor, virus trafficker, inflammation moderator, prostate protector and tumor suppressor". Tumor Biology. 43 (1): 159–176. doi:10.3233/TUB-211502. PMID 34420994 Provjerite vrijednost parametra |pmid= (pomoć).

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]