ASPA

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
ASPA
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4MRI, 2I3C, 2O4H, 2Q51, 2O53, 4NFR, 4MXU, 4TNU

Identifikatori
AliasiASPA
Vanjski ID-jeviOMIM: 608034 MGI: 87914 HomoloGene: 33 GeneCards: ASPA
Lokacija gena (čovjek)
Hromosom 17 (čovjek)
Hrom.Hromosom 17 (čovjek)[1]
Hromosom 17 (čovjek)
Genomska lokacija za ASPA
Genomska lokacija za ASPA
Bend17p13.2Početak3,472,374 bp[1]
Kraj3,503,405 bp[1]
Lokacija gena (miš)
Hromosom 11 (miš)
Hrom.Hromosom 11 (miš)[2]
Hromosom 11 (miš)
Genomska lokacija za ASPA
Genomska lokacija za ASPA
Bend11|11 B4Početak73,304,992 bp[2]
Kraj73,329,596 bp[2]
Ontologija gena
Molekularna funkcija GO:0001948 protein binding
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
metal ion binding
hydrolase activity, acting on ester bonds
aspartoacylase activity
aminoacylase activity
identical protein binding
Ćelijska komponenta Jedro
citoplazma
citosol
Biološki proces metabolizam
cellular amino acid biosynthetic process
aspartate catabolic process
central nervous system myelination
positive regulation of oligodendrocyte differentiation
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000049
NM_001128085

NM_023113

RefSeq (bjelančevina)

NP_000040
NP_001121557

NP_075602

Lokacija (UCSC)Chr 17: 3.47 – 3.5 MbChr 11: 73.3 – 73.33 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Aspartoacilaza
ASPA dimer.png
Struktura dimera aspartoacilaze, generirana iz 2I3C.[5]
Identifikatori
SimbolASPA

Aspartoacilaza je hidrolazni enzim (EC 3.5.1.15, aminoacilaza II, N-acetilaspartat amidohidrolaza, acetil –aspartat deaminaza, acilaza II, ASPA), koja je kod ljudi kodirana genom ASPA. ASPA je odgovoran za kataliziranje deacilacije N-acetil-l-aspartata (N-acetilaspartata) u aspartansku kiselinu i acetat.[6][7] To je cink-zavisna hidrolaza koja promovira deprotoniranje vode da bi se koristila kao nukleofil u mehanizmu analognom mnogim drugim cink-zavisnim hidrolazama.[8] Najčešće se nalazi u mozgu, gdje kontrolira razinu N-aktetil-l-aspartata. Mutacije koje rezultiraju gubitkom aktivnosti aspartoacilaze povezane su sa Canavanovom bolešću, rijetkim autosomno recesivnim neurodegenerativnim poremećajem.[9]

Struktura[uredi | uredi izvor]

Dužina polipeptidnog lanca je 313 aminokiselina, a molekulska težina 35.735 Da.[10].

Aminokiselinska sekvenca

1020304050
MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKP
FITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLF
GPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPL
PCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIK
HALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQ
DWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTK
LTLNAKSIRCCLH
Simboli

Aspartoacilaza je dimer dva identična monomera od 313 aminokiselina i u svakom koristi cink-kofaktor.[5][11] U svakom monomeru postoje dvija različita domena: N-terminalni domen od ostataka 1-212 i C-terminalni od ostataka 213–313.[12] N-terminalni domen aspartoacilaze sličan je domenu hidrolaza zavisnih od cinka, kao što je karboksipeptidaza A. Međutim, karboksipeptidaze nemaju nešto slično C-domenu. U karboksipeptidazi A, aktivno mesto je dostupno velikim supstratima poput glomaznog C-terminalnog ostatka polipeptida, dok je C-domen sterno ometa pristup aktivnom mjestu aspartoacilaze. Umjesto toga, N-domen i C-domen aspartoacilaze čine duboki uski kanal koji vodi do aktivnog mjesta.

Kofaktor cinka nalazi se na aktivnom mjestu, a drže ga Glu-24, His-21 i His 116.[13] Podlogu (supstrat) drže Arg-63, Asn-70, Arg-71, Tyr-164, Arg-168 i Tyr-288. Cinkov kofaktor koristi se za snižavanje pK vode, povezane vode tako da može doći do napada na N-acetil-L-aspartat i za stabilizaciju rezultirajućeg tetraedarskog međuprodukta, zajedno sa Arg-63 i Glu-178.[13]

Monomer aspartoacilaze s N-domenom u zelenoj, C-domenom u žutoj i cinkovim kofaktorom u crvenoj boji. Generirano iz 2I3C.[5]

Aktivno mjesto aspartoacilaze s vezanim N-fosfonamidat-L- aspartat. Ovo je tetraedrični srednji analog sa fosforom koji zamjenjuje napadnuti ugljik. U strukturi, cink, Arg-63 i Glu-178 stabiliziraju tetraedarski intermedijer. Generirano iz 2O4H.[13]

Mehanizam[uredi | uredi izvor]

Postoje dva tipa mogućih mehanizama za hidrolaze ovisne o cinku, ovisno o tome što je nukleofil. Prva koristi deprotoniranu vodu, a druga napada s aspartat ili glutamat, prvo formirajući anhidrid.[14] Aspartoacilaza slijedi deprotonirani vodeni mehanizam.[13] Cink snižava pKa podvezane molekule vode i reakcija se nastavlja napadom na N-acetil-l-aspartat, kada se molekula vode deprotonira glukozom 178.[5] To dovodi do tetraedarskog intermedijera koji je stabiliziran cinkom, Arg-63 i Glu-178.[13] Konačno, karbonil se zatim reformira, veza s dušikom se prekida i protok protonira dušik, protonom koji uzima Glu-178, u jednom usklađenom koraku.[14]

Mehanizam djelovanja aspartoailaze[13]

Biološka funkcija[uredi | uredi izvor]

Aspartoacilaza se koristi za metabolizaciju N-acetil-L-aspartata, katalizirajući njegovu deacilaciju. Aspartoacilaza sprečava nakupljanje N-acetil-L-aspartata u mozgu. Smatra se da je kontrola nivoa N-acetil-L-aspartata od suštinske važnosti za razvoj i održavanje bijele tvari.[5] Nije poznato zašto se toliko mnogo N-acetil-L-aspartata stvara u mozgu, niti koja je njegova primarna funkcija.[15] Međutim, jedna od hipoteza je da se potencijalno koristi kao hemijski rezervoar u koji se može iskoristiti acetat za sintezu acetil-CoA ili aspartat za sintezu glutamata.[15][16] Na taj se način, N-acetil-L-aspartat može se koristiti za transport ovih prekursorskih molekula, a aspartoacilaza se koristi za njihovo oslobađanje. Naprimjer, N-acetil-L-aspartat proizveden u neuronima može se transportirati u oligodendrocite, a oslobođeni acetat se može koristiti za sintezu mijelina.[12][17] Druga hipoteza je da je N-acetil-L-aspartat esencijalni osmolit koji djeluje kao molekulska pumpa za vodu koja pomaže u održavanju pravilne ravnoteže tečnosti u mozgu.[18]

Klinički značaj[uredi | uredi izvor]

Mutacije koji su dovele do gubitka aktivnosti aspartoacilaze identifikovane su kao uzrok Canavanove bolesti.[19] Canavanova bolest je rijedak autosomno recesivni poremećaj koji uzrokuje spužvastu degeneraciju bijele materije u mozgu i ozbiljnu psihomotornu retardaciju, koja obično dovodi do smrti u mladoj dobi.[12][20] The loss of aspartoacylase activity leads to the buildup of N-acetyl-L-aspartate in the brain and an increase in urine concentration by up to 60 times normal levels.[19] Iako tačan mehanizam kako gubitak aktivnosti aspartoacilaze dovodi do Canavanove bolesti nije u potpunosti razumljiv, postoje dva osnovna konkurentska objašnjenja. Prvo je da dovodi do neispravne sinteze mijelina zbog nedostatka acetil-CoA izvedenog iz acetata.[20] Drugo objašnjenje je da povišeni nivoi N-acetil-l-aspartata ometaju njegov normalan osmoregulacijski mehanizam , što dovodi do osmotske neravnoteže.[21]

Prijavljeno je preko 70 mutacija ovog enzima, ali najčešće su supstitucije aminokiselina E285A i A305E.[12] E285A smanjuje aktivnost aspartoacilaze na samo 0,3% svoje normalne funkcije i nalazi se u 98% slučajeva kod potomaka Aškenazi Jevreja.[22] Mutacija A305E nalazi se u oko 40% nejevrejskih pacijenata i smanjuje aktivnost na oko 10%. Od ove dvije mutacije uzeta je kristalna struktura mutanta E285A, što pokazuje da gubitak vodikove veze iz glutamata dovodi do promjene konformacijse p koja iskrivljuje aktivno mjesto i mijenja vezivanje supstrata, što dovodi do znatno niže katalitske aktivnosti.[12]

Iskrivljenje aktivnog mjesta uzrokovano mutacijom E285A. Divlji tip ASPA je s lijeve strane (2O4H[5]) a E285A na desnoj (4NFR[12]).

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000108381 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000020774 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b c d e f Bitto E, Bingman CA, Wesenberg GE, McCoy JG, Phillips GN (januar 2007). "Structure of aspartoacylase, the brain enzyme impaired in Canavan disease". Proceedings of the National Academy of Sciences of the United States of America. 104 (2): 456–61. doi:10.1073/pnas.0607817104. PMC 1766406. PMID 17194761.
  6. ^ Birnbaum SM (1955). Aminoacylase. Amino acid aminoacylases I and II from hog kidney. Methods Enzymol. Methods in Enzymology. 2. str. 115–119. doi:10.1016/S0076-6879(55)02176-9. ISBN 9780121818029.
  7. ^ Birnbaum SM, Levintow L, Kingsley RB, Greenstein JP (januar 1952). "Specificity of amino acid acylases". The Journal of Biological Chemistry. 194 (1): 455–70. PMID 14927637.
  8. ^ Le Coq J, An HJ, Lebrilla C, Viola RE (maj 2006). "Characterization of human aspartoacylase: the brain enzyme responsible for Canavan disease". Biochemistry. 45 (18): 5878–84. doi:10.1021/bi052608w. PMC 2566822. PMID 16669630.
  9. ^ Hershfield JR, Pattabiraman N, Madhavarao CN, Namboodiri MA (maj 2007). "Mutational analysis of aspartoacylase: implications for Canavan disease". Brain Research. 1148: 1–14. doi:10.1016/j.brainres.2007.02.069. PMC 1933483. PMID 17391648.
  10. ^ "UniProt, P45381". Pristupljeno 21. 6. 2021.
  11. ^ Herga S, Berrin JG, Perrier J, Puigserver A, Giardina T (oktobar 2006). "Identification of the zinc binding ligands and the catalytic residue in human aspartoacylase, an enzyme involved in Canavan disease". FEBS Letters. 580 (25): 5899–904. doi:10.1016/j.febslet.2006.09.056. PMID 17027983. S2CID 41351955.
  12. ^ a b c d e f Wijayasinghe YS, Pavlovsky AG, Viola RE (august 2014). "Aspartoacylase catalytic deficiency as the cause of Canavan disease: a structural perspective". Biochemistry. 53 (30): 4970–8. doi:10.1021/bi500719k. PMID 25003821.
  13. ^ a b c d e f Le Coq J, Pavlovsky A, Malik R, Sanishvili R, Xu C, Viola RE (mart 2008). "Examination of the mechanism of human brain aspartoacylase through the binding of an intermediate analogue". Biochemistry. 47 (11): 3484–92. doi:10.1021/bi702400x. PMC 2666850. PMID 18293939.
  14. ^ a b Zhang C, Liu X, Xue Y (januar 2012). "A general acid–general base reaction mechanism for human brain aspartoacylase: A QM/MM study". Computational and Theoretical Chemistry. 980: 85–91. doi:10.1016/j.comptc.2011.11.023.
  15. ^ a b Moffett JR, Arun P, Ariyannur PS, Namboodiri AM (decembar 2013). "N-Acetylaspartate reductions in brain injury: impact on post-injury neuroenergetics, lipid synthesis, and protein acetylation". Frontiers in Neuroenergetics. 5: 11. doi:10.3389/fnene.2013.00011. PMC 3872778. PMID 24421768.
  16. ^ Hershfield JR, Madhavarao CN, Moffett JR, Benjamins JA, Garbern JY, Namboodiri A (oktobar 2006). "Aspartoacylase is a regulated nuclear-cytoplasmic enzyme". FASEB Journal. 20 (12): 2139–41. doi:10.1096/fj.05-5358fje. PMID 16935940. S2CID 36296718.
  17. ^ Chakraborty G, Mekala P, Yahya D, Wu G, Ledeen RW (august 2001). "Intraneuronal N-acetylaspartate supplies acetyl groups for myelin lipid synthesis: evidence for myelin-associated aspartoacylase". Journal of Neurochemistry. 78 (4): 736–45. doi:10.1046/j.1471-4159.2001.00456.x. PMID 11520894. S2CID 23338456.
  18. ^ Baslow MH (april 2002). "Evidence supporting a role for N-acetyl-L-aspartate as a molecular water pump in myelinated neurons in the central nervous system. An analytical review". Neurochemistry International. 40 (4): 295–300. doi:10.1016/s0197- boleat 0186(01)00095-x Provjerite vrijednost parametra |doi= (pomoć). PMID 11792458. S2CID 34902757.
  19. ^ a b Moore RA, Le Coq J, Faehnle CR, Viola RE (maj 2003). "Purification and preliminary characterization of brain aspartoacylase". Archives of Biochemistry and Biophysics. 413 (1): 1–8. doi:10.1016/s0003-9861(03)00055-9. PMID 12706335.
  20. ^ a b Namboodiri AM, Peethambaran A, Mathew R, Sambhu PA, Hershfield J, Moffett JR, Madhavarao CN (juni 2006). "Canavan disease and the role of N-acetylaspartate in myelin synthesis". Molecular and Cellular Endocrinology. 252 (1–2): 216–23. doi:10.1016/j.mce.2006.03.016. PMID 16647192. S2CID 12255670.
  21. ^ Baslow MH, Guilfoyle DN (april 2013). "Canavan disease, a rare early-onset human spongiform leukodystrophy: insights into its genesis and possible clinical interventions". Biochimie. 95 (4): 946–56. doi:10.1016/j.biochi.2012.10.023. PMID 23151389.
  22. ^ Zano S, Wijayasinghe YS, Malik R, Smith J, Viola RE (januar 2013). "Relationship between enzyme properties and disease progression in Canavan disease". Journal of Inherited Metabolic Disease. 36 (1): 1–6. doi:10.1007/s10545-012-9520-z. PMID 22850825. S2CID 34211521.

Vanjski linkovi[uredi | uredi izvor]

Šablon:Ugljično-dušične nepeptidne hidrolaze