CCL21

S Wikipedije, slobodne enciklopedije
CCL21
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2L4N

Identifikatori
AliasiCCL21
Vanjski ID-jeviOMIM: 602737 MGI: 1349183 HomoloGene: 2247 GeneCards: CCL21
Lokacija gena (čovjek)
Hromosom 9 (čovjek)
Hrom.Hromosom 9 (čovjek)[1]
Hromosom 9 (čovjek)
Genomska lokacija za CCL21
Genomska lokacija za CCL21
Bend9p13.3Početak34,709,005 bp[1]
Kraj34,710,136 bp[1]
Lokacija gena (miš)
Hromosom 4 (miš)
Hrom.Hromosom 4 (miš)[2]
Hromosom 4 (miš)
Genomska lokacija za CCL21
Genomska lokacija za CCL21
Bend4 A5|4 22.81 cMPočetak42,772,860 bp[2]
Kraj42,773,993 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija cytokine activity
chemokine receptor binding
CCR7 chemokine receptor binding
chemokine activity
CCR chemokine receptor binding
GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta extracellular region
Vanćelijsko
Biološki proces negative regulation of leukocyte tethering or rolling
release of sequestered calcium ion into cytosol
positive regulation of receptor-mediated endocytosis
positive regulation of protein kinase B signaling
positive regulation of cell motility
positive regulation of actin filament polymerization
monocyte chemotaxis
GO:0032861, GO:0032862, GO:0032856 activation of GTPase activity
ruffle organization
positive regulation of cell-matrix adhesion
chemokine-mediated signaling pathway
cellular response to tumor necrosis factor
cell-cell signaling
T cell costimulation
cell maturation
positive regulation of JNK cascade
dendritic cell chemotaxis
negative regulation of dendritic cell dendrite assembly
positive regulation of phosphatidylinositol 3-kinase activity
Hemotaksija
response to prostaglandin E
positive regulation of dendritic cell antigen processing and presentation
dendritic cell dendrite assembly
positive regulation of pseudopodium assembly
mesangial cell-matrix adhesion
positive regulation of chemotaxis
cellular response to interleukin-1
GO:0046730, GO:0046737, GO:0046738, GO:0046736 Imuni odgovor
establishment of T cell polarity
positive regulation of ERK1 and ERK2 cascade
positive regulation of glycoprotein biosynthetic process
cellular response to interferon-gamma
positive regulation of I-kappaB kinase/NF-kappaB signaling
cell chemotaxis
lymphocyte chemotaxis
positive regulation of neutrophil chemotaxis
positive regulation of cell adhesion mediated by integrin
immunological synapse formation
positive regulation of filopodium assembly
positive regulation of T cell migration
positive regulation of myeloid dendritic cell chemotaxis
positive regulation of protein kinase activity
inflammatory response
antimicrobial humoral immune response mediated by antimicrobial peptide
regulation of signaling receptor activity
G protein-coupled receptor signaling pathway
negative regulation of dendritic cell apoptotic process
positive regulation of T cell chemotaxis
neutrophil chemotaxis
chemokine (C-C motif) ligand 21 signaling pathway
GO:0032320, GO:0032321, GO:0032855, GO:0043089, GO:0032854 positive regulation of GTPase activity
cellular response to chemokine
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_002989

NM_011124

RefSeq (bjelančevina)

NP_002980

NP_035254

Lokacija (UCSC)Chr 9: 34.71 – 34.71 MbChr 4: 42.77 – 42.77 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Hemokinski (C-C motivni) ligand 21 (CCL21) jest mali citokin hemokinske porodice CC. Ovaj hemokin je poznat i kao 6Ckin (jer ima šest konzerviranih cisteinskih ostataka umjesto četiri cisteina tipska za hemokine), egzodus-2 i sekundarni limfoidni tkivni hemokin (SLC).[5][6][7]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 134 aminokiseline, а molekulska težina 14.646 Da.[8]

1020304050
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRK
QEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPA
QGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP

Gen[uredi | uredi izvor]

Gen za CCL21 se nalazi na ljudskom hromohomu 9. CCL21 izaziva svoje efekte vezanjem za ćelijsku površinu hemokinski receptor poznat kao CCR7.[9]

U ljudskim limfnim čvorovima, fibroblastne mrežaste ćelije (FRC) eksprimiraju CCL21 kao hemoatraktant koji nevine, CCR7 eksprimirajuće T-ćelije vodi u zonu T-ćelija.[10]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000137077 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000094686 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Hedrick JA, Zlotnik A (august 1997). "Identification and characterization of a novel beta chemokine containing six conserved cysteines". Journal of Immunology. 159 (4): 1589–93. PMID 9257816.
  6. ^ Hromas R, Kim CH, Klemsz M, Krathwohl M, Fife K, Cooper S, Schnizlein-Bick C, Broxmeyer HE (septembar 1997). "Isolation and characterization of Exodus-2, a novel C-C chemokine with a unique 37-amino acid carboxyl-terminal extension". Journal of Immunology. 159 (6): 2554–8. PMID 9300671.
  7. ^ Nagira M, Imai T, Hieshima K, Kusuda J, Ridanpää M, Takagi S, Nishimura M, Kakizaki M, Nomiyama H, Yoshie O (august 1997). "Molecular cloning of a novel human CC chemokine secondary lymphoid-tissue chemokine that is a potent chemoattractant for lymphocytes and mapped to chromosome 9p13". The Journal of Biological Chemistry. 272 (31): 19518–24. doi:10.1074/jbc.272.31.19518. PMID 9235955.
  8. ^ "UniProt, O00585". Pristupljeno 2021-09-0. Provjerite vrijednost datuma u parametru: |access-date= (pomoć)
  9. ^ Yoshida R, Nagira M, Kitaura M, Imagawa N, Imai T, Yoshie O (mart 1998). "Secondary lymphoid-tissue chemokine is a functional ligand for the CC chemokine receptor CCR7". The Journal of Biological Chemistry. 273 (12): 7118–22. doi:10.1074/jbc.273.12.7118. PMID 9507024.
  10. ^ Mueller SN, Germain RN (septembar 2009). "Stromal cell contributions to the homeostasis and functionality of the immune system". Nature Reviews. Immunology. 9 (9): 618–29. doi:10.1038/nri2588. PMC 2785037. PMID 19644499.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]