Ubikvitin

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
Porodica ubikvitina
Ubiquitin cartoon-2-.png
Dijagram ubikvitina. Sedam lizinskih bočnih lanaca prikazano je žuto /narandžasto
Identifikatori
Simbolubiquitin
PfamPF00240
InterProIPR000626
PROSITEPDOC00271
SCOP21aar / SCOPe / SUPFAM
Dostupne proteinske strukture:
Pfam  strukture / ECOD  
PDBRCSB PDB; PDBe; PDBj
PDBsumsažetak strukture

Ubikvitin (latinski: ubique praesentes = sveprisutno) je mali (8,6 kDa) regulatorni protein koji se nalazi u većini tkiva eukariotskih organizama, tj. nalazi se sveprisutno. Otkrio ga je Gideon Goldstein, 1975., a dalje je karakteriziran tokom kasnih 1970-ih i 1980-ih.[1] Ubikvitin u ljudskom genomu kodiraju četiri gena: UBB, UBC, UBA52 i RPS27A.

Dodatak ubikvitina supstratnom proteinu naziva se ubikvilacija (ili, alternativno, ubikvitinacija ili ubikvitinilacija). Ubikvilacija utiče na proteine na mnogo načina: može ih označiti za razgradnju putem proteasoma, promijeniti njihovu ćelijsku lokaciju, uticati na njihovu aktivnost i promovirati ili spriječiti proteinske interakcije. Uključuje tri glavna koraka: aktivaciju, konjugaciju i ligaciju, šro izvode ubikvitin-aktivirajući enzimi (E1s), ubikvitin-konjugirajući enzimi (E2s), odnosno ubikvitin-ligaza (E3s). Rezultat ove sekvencijske kaskade je vezanje ubikvitina na lizinske ostatke na proteinskoj podlozi putem izopeptidne veze, cisteinskih ostataka preko tioesterske veze, serinskih i treoninskih ostataka putem esterske veze ili amino grupa proteinskog N-kraja, putem peptidne veze.

Modifikacije proteina mogu biti ili jedan protein ubikvitina (monoubikvilacija) ili lanac ubikvitina (poliubikvitilacija). Sekundarne molekule ubikvitina su uvijek povezane sa jednim od sedam lizinskih ostataka ili N-terminalnim metioninom prethodne molekule ubikvitina. Ovi ostaci 'povezivanja' predstavljeni su s "K" ili "M" (jednoznačna oznaka aminokiselina lizina i metionina) i brojem, koji se odnosi na njegov položaj u molekuli ubikvitina kao u K48 , K29 ili M1. Prva molekula ubikvitina kovalentno je vezana preko C-terminalne karboksilatne grupe za određeni lizin, cistein, serin, treonin ili N-kraj ciljanog proteina. Poliubikvitilacija se javlja kada je C-kraj drugog ubikvitina povezan sa jednim od sedam ostataka lizina ili prvim metioninom na prethodno dodanoj molekuli ubikvitina, stvarajući lanac. Ovaj postupak se ponavlja nekoliko puta, što dovodi do dodavanja nekoliko ubikvitina. Samo poliubikvilacija na definiranim lizinima, uglavnom na K48 i K29, povezana je s razgradnjom putem proteasoma (naziva se "molekulski poljubac smrti"), dok su druge poliubikvilacije (npr. Na K63, K11, K6 i M1) i monoubikvitilacije mogu regulirati procese kao što su promet endocita, upala, translacija i popravak DNK.

Otkriće da lanci ubikvitina ciljaju proteine na proteasom, koji razgrađuje i reciklira proteine, počašćeno je Nobelovom nagradom za hemiju 2004. godine.[2][3][4]

Identifikacija[uredi | uredi izvor]

Površina ubikvitina

Ubikvitin (izvorno, sveprisutni imunopoetski polipeptid) prvi je put identificiran 1975. godine[5] kao 8,6 kDa protein, eksprimiran u svim eukariotskim ćelijama. Osnovne funkcije ubikvitina i komponente puta ubikvitilacije su početkom 1980-ih u Technion-u objasnili Aaron Ciechanover, Avram Hershko i Irwin Rose za koje su dobili Nobelovu nagrada za hemiju. 2004.

Ubikvitilacijski sistem je u početku okarakteriziran kao ATP-ovisni proteolitski sistem u ćelijskim ekstraktima. Utvrđeno je da je termički stabilan polipeptid prisutan u ovim ekstraktima, ATP-zavisni faktor proteolize 1 (APF-1), kovalentno vezan za modelni proteinski supstratni lizozim u procesu koji je zavisi od ATP i Mg2+.[6] Više molekula APF-1 povezano je s jednom molekulom supstrata, pomoću izopeptidne veze, a utvrđeno je da se konjugati brzo razgrađuju oslobađanjem slobodnog APF-1. Ubrzo nakon što je okarakterizirana konjugacija proteina APF-1, APF-1, identificiran je kao ubikvitin. Karboksilna grupa C-terminalnog glicinskog ostatka ubikvitina (Gly76) identificirana je kao ostatak konjugiran sa supstratnim lizinskim ostacima.

Protein[uredi | uredi izvor]

Svojstva ljudskog ubikvitina
Broj ostataka 76
Molekulska masa 8564.8448 Da
Izoelektrična tačka (pI) 6.79
Gen RPS27A (UBA80, UBCEP1), UBA52 (UBCEP2), UBB, UBC
Sekenca (aminokiselina) MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPD

QQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG

Ubikvitin je mali protein u svim eukariotskim ćelijama. Svoje bezbrojne funkcije obavlja putem konjugacije sa velikim brojem ciljnih proteina. Može se pojaviti čitav niz različitih modifikacija. Sam protein ubikvitin sastoji se od 76 aminokiselina i ima molekulsku masu oko 8,6 kDa. Ključne karakteristike uključuju njegov rep na C-terminalu i sedam lizinski ostataka. Visoko je konzerviran tokom evolucije eukariota; ubikvitin ljudi i kvasaca ima 96% identiteta sekvence

Geni[uredi | uredi izvor]

Ubikvitin je kod sisara kodiran sa četiri različita gena. UBA52 i RPS27A kodiraju jednu kopiju ubikvitina spojenog sa ribosomskim proteinima L40, odnosno S27a. Geni UBB i UBC kodiraju prekurssorske proteine poliubikvitina.[7]

Ubikvitilacija[uredi | uredi izvor]

Sistem ubikvitilacije (prikazuje RING E3 ligazu).

Ubikvitilacija (poznata i kao ubikvitinacija ili ubikvitinilacija) je enzimske posttranslacijska modifikacija u kojoj je protein ubikvitin vezan za enzimski supstratni protein. Ovaj postupak najčešće veže posljednju aminokiselinu ubikvitina (glicin 76) za ostatak lizina na podlozi. Izopeptidna veza nastaje između karboksil grupe (COO) ubikvitinovog glicina i epsilon – amino grupe (ε- NH +
3
) lizinskog supstrata.[8] Tripsinsko cijepanje supstrata konjugiranog s ubikvitinom ostavlja "ostatak" di-glicina koji se koristi za identificiranje mjesta ubikvilacije.[9][10] Ubikvitin se takođe može vezati za druga mesta u proteinu koja su elektronama bogata nukleofilima, nazvana "nekanonska sveprisutnost".[11] To je prvi put uočeno kod aminogrupe proteinskog N-kraja, koji se koristi za ubikvuitilaciju, umjesto ostatka lizina, u proteinu MyoD [12] i od tada je primijećen u 22 druga proteina u više vrsta i tipova,[13][14][15][16][17][18][19][20][21][22][23][24][25][26][27][28][29][30][31] ukljućujući i sam ubikvitin.[32] Također je sve više dokaza o ostacima nelizina kao ciljevima ubikvilacije upotrebom neaminskih grupa, kao što je sulfhidrilna grupa na cisteinu,[33][34][35][36][37][38][39][40] i hidroksil grupa na treoninu i serinu.[28][29][33][39][40][41][42][43][44] Krajnji rezultat ovog postupka je dodavanje jedne molekule ubikvitina (monoubikvitilacija) ili lanca molekula ubikvitina (poliubikvitinacija) proteiskog supstrata.[45]

Za ubikvitinaciju su potrebna tri tipa enzima: ubikvitin-aktivirajući enzim, ubikvitin-konjugirajući enzim i ubikvitin-ligaza, poznati kao E1s, E2s i E3s. Proces se sastoji od tri glavna koraka:

  1. Aktivacija: Ubikvitin se aktivira u reakciji u dva koraka pomoću E1 enzim koji aktivira ubikvitin, što ovisi o ATP. Početni korak uključuje proizvodnju intermedijera ubikvitin-adenilata. E1 veže i ATP i ubikvitin i katalizira acil-adenilaciju C-kraja molekule ubikvitina. Drugi korak prenosi ubikvitin na aktivno mesto cisteinskog ostatka, uz oslobađanje AMP. Ovaj korak rezultira tioesterskom vezom između C-terminalne karboksilne grupe ubikvitina i E1 cisteinske sulfhidrilne grupe.[8][46] Ljudski genom sadrži dva gena koji proizvode enzime sposobne za aktiviranje ubikvitina: UBA1 i UBA6.[47]
  2. Konjugacija: E2 ubikvitin-konjugirajući enzimi kataliziraju transfer ubikvitina iz E1 u aktivno mesto cisteina E2 putem reakcije trans (tio) esterifikacije. Da bi izveo ovu reakciju, E2 se veže i za aktivirani ubikvitin i za enzim E1. Ljudi posjeduju 35 različitih enzima E2, dok ih ostali eukarioti imaju između 16 i 35. Karakterizira ih visoko konzervirana struktura, poznata kao ubikvitin-konjugirajući katalitski nabor (UBC).[48]
Glicin i lizin povezani izopeptidnom vezom. Izopeptidna veza je istaknuta žutom bojom.
  1. Ligacija: E3 ubikvitin-ligaza katalizira završni korak kaskade ubikvitinacije. Najčešće stvaraju izopeptidnu vezu između lizina ciljnog proteina i C-terminalnog ubikvitinskog glicina. Općenito, ovaj korak zahtijeva aktivnost jednog od stotina E3. Enzimi E3 funkcioniraju kao supstrat moduli za prepoznavanje sistema i sposobni su za interakciju s E2 i supstrat. Neki enzimi E3 također aktiviraju enzime E2. E3 enzimi imaju jedan od dva domena: homologni E6-AP karboksilnom C-kraju (HECT) i zaista zanimljiv novi gen (RING) domen (ili usko povezana U-boks domen). HECT domen E3 u ovom procesu privremeno veže ubikvitin (obvezni tioesterski intermedijar nastaje s cisteinskog aktivnog mjesta E3), dok RING domen E3 katalizira direktan prenos sa enzima E2 na supstrat.[49] Kompleks za promociju anafaze (APC) i SCF kompleks (za proteinski kompleks Skp1-Cullin-F-boks) dva su primjera multipodjedinica E3, uključenih u prepoznavanje i ubikvitinaciju specifičnih ciljnih proteina za razgradnju od putem proteasoma.[50]

U kaskadi ubikvitinacije, E1 se može vezati za mnogo E2, koji se mogu hijerarhijski vezati za stotine E3. Postojanje nivoa unutar kaskade omogućava strogu regulaciju mehanizma za ubikvitinaciju.[51] Ostali proteini slični ubikvitinu (UBL) također se modificiraju putem kaskade E1-E2-E3, iako postoje varijacije u tim sistemima.[52]

Enzimi E4 ili faktori produženja lanca ubikvitina sposobni su za dodavanje unaprijed formiranih poliubikvitinskih lanaca u supstratne proteine.[53] Naprimjer, višestruki monoubikvitilacijski supresor tumora p53 putem Mdm2[54] može biti praćeno dodavanjem lanca poliubikvitina, upotrebom p300 i CBP.[55][56]

Struktura[uredi | uredi izvor]

Različito povezani lanci imaju specifične učinke na protein za koji su vezani, uzrokovano razlikama u konformacijama proteinskih lanaca. K29–, K33–,[57] K63– M1-vezani lanci imaju prilično linearnu konformaciju; poznati su kao lanci otvorene konformacije. Vezani lanci K6–, K11– i K48 čine zatvorene konformacije. Molekule ubikvitina u lancima otvorene konformacije ne djeluju međusobno, osim kovalentne izopeptidne veze koja ih spaja. Suprotno tome, zatvoreni konformacijski lanci imaju veze s ostacima u interakciji. Promjenom lančanih konformacija izlažu se i prikrivaju različiti dijelovi ubikvitinskih proteina, a različite veze prepoznaju proteini koji su specifični za jedinstvenu topologiju, svojstvenu vezi. Proteini se mogu specifično vezati za ubikvitin putem ubivitinskih vezujućih domena (UBD-ova). Udaljenost između pojedinih jedinica ubikvitina u lancima razlikuje se između lizinskih 63– i 48–vezanih lanaca. UBD-ovi to iskorištavaju tako što imaju male odstojnike između motiva interakcije ubikvitina, koji vežu lizinske 48-vezane lance (kompaktni lanci ubikvitina) i veće odstojnike, za lizinske 63-povezane lance. Mehanizmi koji su uključeni u prepoznavanje poliubikvitinskih lanaca mogu također razlikovati lance povezane sa K63 i M1 poveznice, što pokazuje činjenica da potonji mogu izazvati proteasomsku degradaciju supstrata.[2][58]

Funkcija[uredi | uredi izvor]

Sistem ubikvitinacije funkcionira u širokom spektru ćelijskih procesa, kao što su:[59]

Deubikvitinacija[uredi | uredi izvor]

Deubikvitinirajući enzimi (DUB) protive se ulozi ubikvinacije uklanjanjem ubikvitina iz proteinskog supstrata. Oni su cistein-proteaze koje razdvajaju amidnu vezu između dva proteina. Vrlo su specifični, kao i E3 ligaze, koje vežu ubikvitin, sa samo nekoliko supstrata po enzimu. Mogu razdvojiti i izopeptid (između ubikvitina i lizina) i peptidnu vezu (između ubikvitina i N-kraja).

Pored uklanjanja ubikvitina iz proteinskog supstrata, DUB imaju i mnoge druge uloge unutar ćelije. Ubikvitin se eksprimira kao višestruke kopije spojene u lanac (poliubikvitin) ili je vezan za ribosomske podjedinice. DUB cijepaju ove proteine, da bi proizveli aktivni ubikvitin. Također recikliraju ubikvitin koji je bio vezan za male nukleofilne molekule tokom procesa ubikvitinacije. Monoubikvitin tvore DUB-ovi koji cijepaju ubikvitin iz slobodnih poliubikvitinskih lanaca koji su prethodno uklonjeni iz proteina.[61]

Ubikvitinski vezni domeni[uredi | uredi izvor]

Karakterizacija ubikvitinskih veznih domena
Domen Broj proteina u proteasomu Dužina

(aminkiseline)

Afinitet ubikvitinskog vezanja
CUE S. cerevisiae: 7

H. sapiens: 21

42–43 ~2–160 μM
GATII S. cerevisiae: 2

H. sapiens: 14

135 ~180 μM
GLUE S. cerevisiae: ?

H. sapiens: ?

~135 ~460 μM
NZF S. cerevisiae: 1

H. sapiens: 25

~35 ~100–400 μM
PAZ S. cerevisiae: 5

H. sapiens: 16

~58 Nepoznato
UBA S. cerevisiae: 10

H. sapiens: 98

45–55 ~0.03–500 μM
UEV S. cerevisiae: 2

H. sapiens: ?

~145 ~100–500 μM
UIM S. cerevisiae: 8

H. sapiens: 71

~20 ~100–400 μM
VHS S. cerevisiae: 4

H. sapiens: 28

150 Nepoznato

Ubikvitin-vezujući domeni (UBD) su modularni proteinski domeni koji se nekovalentno vežu za ubikvitin i kontroliraju različite ćelijske događaje. Detaljne molekularne strukture poznate su po brojnim UBD-ima, specifičnost vezanja određuje njihov mehanizam djelovanja i regulacije, te kako reguliraju ćelijske proteine i procese.[62][63]

Vezane bolesti[uredi | uredi izvor]

Put ubikvitina uključen je u patogenezu širokog spektra bolesti i poremećaja, kao što su:[64]

Dijagnostička upotreba[uredi | uredi izvor]

Imunohistohemijska upotreba antitijela za ubikvitin može identificirati abnormalne nakupine ovog proteina unutar ćelija, što ukazuje na proces bolesti. Ove nakupine proteina nazivaju se inkluzijska tijela (što je opći termin za bilo koju mikroskopski vidljivu nakupinu abnormalnog materijala u ćeliji). Primjeri uključuju:

Ljudski proteini sa ubik vitinskim domenom[uredi | uredi izvor]

Ovdje su uključeni ubikvitinoliki protrini:

ANUBL1; BAG1; BAT3/BAG6; C1orf131; DDI1; DDI2; FAU; HERPUD1; HERPUD2; HOPS; IKBKB; ISG15; LOC391257; MIDN; NEDD8; OASL; PARK2; RAD23A; RAD23B; RPS27A; SACS; 8U SF3A1; SUMO1; SUMO2; SUMO3; SUMO4; TMUB1; TMUB2; UBA52; UBB; UBC; UBD; UBFD1; UBL4; UBL4A; UBL4B; UBL7; UBLCP1; UBQLN1; UBQLN2; UBQLN3; UBQLN4; UBQLNL; UBTD1; UBTD2; UHRF1; UHRF2;

Predviđanje ubikvitinacije[uredi | uredi izvor]

Dostupni programi predviđanja su:

  • UbiPred je SVM-zasnovani poslužitelj za predviđanje zasnovan na 31 fizičko-hemijskom svojstvu za predviđanje mjesta ubikvitinacije.[65]
  • UbPred je random forest-zasnovani prediktor potencijalnih mjesta ubikvitinacije u proteinima. Obučeno je na kombiniranom skupu od 266 nepotrebnih eksperimentalno provjerenih mjesta ubikvitinacije, dostupnih iz izvedenih eksperimenata i u dvije velike studije proteomike.[66]
  • CKSAAP_UbSite je predviđanje zasnovano na SVM-u i koristi sastav k-razmaknutih parova aminokiselina koji okružuju mjesto upita (tj. bilo koji lizin u sekvenci upita) kao ulaz, koristi isti skup podataka kao i UbPred.[67]

Također pogledajte[uredi | uredi izvor]

Reference[uredi | uredi izvor]

  1. ^ Wilkinson KD (oktobar 2005). "The discovery of ubiquitin-dependent proteolysis". Proceedings of the National Academy of Sciences of the United States of America. 102 (43): 15280–2. Bibcode:2005PNAS..10215280W. doi:10.1073/pnas.0504842102. PMC 1266097. PMID 16230621.
  2. ^ a b Komander D, Rape M (2012). "The ubiquitin code". Annual Review of Biochemistry. 81: 203–29. doi:10.1146/annurev-biochem-060310-170328. PMID 22524316.
  3. ^ "The Nobel Prize in Chemistry 2004". Nobelprize.org. Pristupljeno 16. 10. 2010.
  4. ^ "The Nobel Prize in Chemistry 2004: Popular Information". Nobelprize.org. Pristupljeno 14. 12. 2013.
  5. ^ Goldstein G, Scheid M, Hammerling U, Schlesinger DH, Niall HD, Boyse EA (januar 1975). "Isolation of a polypeptide that has lymphocyte-differentiating properties and is probably represented universally in living cells". Proceedings of the National Academy of Sciences of the United States of America. 72 (1): 11–5. Bibcode:1975PNAS...72...11G. doi:10.1073/pnas.72.1.11. PMC 432229. PMID 1078892.
  6. ^ Ciechanover A, Hod Y, Hershko A (august 2012). "A heat-stable polypeptide component of an ATP-dependent proteolytic system from reticulocytes. 1978". Biochemical and Biophysical Research Communications. 425 (3): 565–70. doi:10.1016/j.bbrc.2012.08.025. PMID 22925675.
  7. ^ Kimura Y, Tanaka K (juni 2010). "Regulatory mechanisms involved in the control of ubiquitin homeostasis". Journal of Biochemistry. 147 (6): 793–8. doi:10.1093/jb/mvq044. PMID 20418328.
  8. ^ a b Pickart CM (2001). "Mechanisms underlying ubiquitylation". Annual Review of Biochemistry. 70: 503–33. doi:10.1146/annurev.biochem.70.1.503. PMID 11395416.
  9. ^ Marotti LA, Newitt R, Wang Y, Aebersold R, Dohlman HG (april 2002). "Direct identification of a G protein ubiquitylation site by mass spectrometry". Biochemistry. 41 (16): 5067–74. doi:10.1021/bi015940q. PMID 11955054.
  10. ^ Peng J, Schwartz D, Elias JE, Thoreen CC, Cheng D, Marsischky G, Roelofs J, Finley D, Gygi SP (august 2003). "A proteomics approach to understanding protein ubiquitylation". Nature Biotechnology. 21 (8): 921–6. doi:10.1038/nbt849. PMID 12872131. S2CID 11992443.
  11. ^ McDowell GS, Philpott A (august 2013). "Non-canonical ubiquitylation: mechanisms and consequences". The International Journal of Biochemistry & Cell Biology. 45 (8): 1833–42. doi:10.1016/j.biocel.2013.05.026. PMID 23732108.
  12. ^ Breitschopf K, Bengal E, Ziv T, Admon A, Ciechanover A (oktobar 1998). "A novel site for ubiquitylation: the N-terminal residue, and not internal lysines of MyoD, is essential for conjugation and degradation of the protein". The EMBO Journal. 17 (20): 5964–73. doi:10.1093/emboj/17.20.5964. PMC 1170923. PMID 9774340.
  13. ^ Bloom J, Amador V, Bartolini F, DeMartino G, Pagano M (oktobar 2003). "Proteasome-mediated degradation of p21 via N-terminal ubiquitinylation". Cell. 115 (1): 71–82. doi:10.1016/S0092-8674(03)00755-4. PMID 14532004. S2CID 15114828.
  14. ^ Scaglione KM, Basrur V, Ashraf NS, Konen JR, Elenitoba-Johnson KS, Todi SV, Paulson HL (juni 2013). "The ubiquitin-conjugating enzyme (E2) Ube2w ubiquitinates the N terminus of substrates". The Journal of Biological Chemistry. 288 (26): 18784–8. doi:10.1074/jbc.C113.477596. PMC 3696654. PMID 23696636.
  15. ^ Sadeh R, Breitschopf K, Bercovich B, Zoabi M, Kravtsova-Ivantsiv Y, Kornitzer D, Schwartz A, Ciechanover A (oktobar 2008). "The N-terminal domain of MyoD is necessary and sufficient for its nuclear localization-dependent degradation by the ubiquitin system". Proceedings of the National Academy of Sciences of the United States of America. 105 (41): 15690–5. Bibcode:2008PNAS..10515690S. doi:10.1073/pnas.0808373105. PMC 2560994. PMID 18836078.
  16. ^ Coulombe P, Rodier G, Bonneil E, Thibault P, Meloche S (juli 2004). "N-Terminal ubiquitylation of extracellular signal-regulated kinase 3 and p21 directs their degradation by the proteasome". Molecular and Cellular Biology. 24 (14): 6140–50. doi:10.1128/MCB.24.14.6140-6150.2004. PMC 434260. PMID 15226418.
  17. ^ Kuo ML, den Besten W, Bertwistle D, Roussel MF, Sherr CJ (august 2004). "N-terminal polyubiquitylation and degradation of the Arf tumor suppressor". Genes & Development. 18 (15): 1862–74. doi:10.1101/gad.1213904. PMC 517406. PMID 15289458.
  18. ^ Ben-Saadon R, Fajerman I, Ziv T, Hellman U, Schwartz AL, Ciechanover A (oktobar 2004). "The tumor suppressor protein p16(INK4a) and the human papillomavirus oncoprotein-58 E7 are naturally occurring lysine-less proteins that are degraded by the ubiquitin system. Direct evidence for ubiquitylation at the N-terminal residue". The Journal of Biological Chemistry. 279 (40): 41414–21. doi:10.1074/jbc.M407201200. PMID 15254040.
  19. ^ Li H, Okamoto K, Peart MJ, Prives C (februar 2009). "Lysine-independent turnover of cyclin G1 can be stabilized by B'alpha subunits of protein phosphatase 2A". Molecular and Cellular Biology. 29 (3): 919–28. doi:10.1128/MCB.00907-08. PMC 2630686. PMID 18981217.
  20. ^ Reinstein E, Scheffner M, Oren M, Ciechanover A, Schwartz A (novembar 2000). "Degradation of the E7 human papillomavirus oncoprotein by the ubiquitin-proteasome system: targeting via ubiquitylation of the N-terminal residue". Oncogene. 19 (51): 5944–50. doi:10.1038/sj.onc.1203989. PMID 11127826.
  21. ^ Aviel S, Winberg G, Massucci M, Ciechanover A (august 2000). "Degradation of the epstein-barr virus latent membrane protein 1 (LMP1) by the ubiquitin-proteasome pathway. Targeting via ubiquitylation of the N-terminal residue". The Journal of Biological Chemistry. 275 (31): 23491–9. doi:10.1074/jbc.M002052200. PMID 10807912.
  22. ^ Ikeda M, Ikeda A, Longnecker R (august 2002). "Lysine-independent ubiquitylation of Epstein-Barr virus LMP2A". Virology. 300 (1): 153–9. doi:10.1006/viro.2002.1562. PMID 12202215.
  23. ^ Yang J, Hong Y, Wang W, Wu W, Chi Y, Zong H, Kong X, Wei Y, Yun X, Cheng C, Chen K, Gu J (maj 2009). "HSP70 protects BCL2L12 and BCL2L12A from N-terminal ubiquitylation-mediated proteasomal degradation". FEBS Letters. 583 (9): 1409–14. doi:10.1016/j.febslet.2009.04.011. PMID 19376117. S2CID 32330510.
  24. ^ Wang Y, Shao Q, Yu X, Kong W, Hildreth JE, Liu B (maj 2011). "N-terminal hemagglutinin tag renders lysine-deficient APOBEC3G resistant to HIV-1 Vif-induced degradation by reduced polyubiquitylation". Journal of Virology. 85 (9): 4510–9. doi:10.1128/JVI.01925-10. PMC 3126286. PMID 21345952.
  25. ^ Trausch-Azar JS, Lingbeck J, Ciechanover A, Schwartz AL (juli 2004). "Ubiquitin-Proteasome-mediated degradation of Id1 is modulated by MyoD". The Journal of Biological Chemistry. 279 (31): 32614–9. doi:10.1074/jbc.M403794200. PMID 15163661.
  26. ^ Trausch-Azar J, Leone TC, Kelly DP, Schwartz AL (decembar 2010). "Ubiquitin proteasome-dependent degradation of the transcriptional coactivator PGC-1{alpha} via the N-terminal pathway". The Journal of Biological Chemistry. 285 (51): 40192–200. doi:10.1074/jbc.M110.131615. PMC 3001001. PMID 20713359.
  27. ^ Fajerman I, Schwartz AL, Ciechanover A (februar 2004). "Degradation of the Id2 developmental regulator: targeting via N-terminal ubiquitylation". Biochemical and Biophysical Research Communications. 314 (2): 505–12. doi:10.1016/j.bbrc.2003.12.116. PMID 14733935.
  28. ^ a b Vosper JM, McDowell GS, Hindley CJ, Fiore-Heriche CS, Kucerova R, Horan I, Philpott A (juni 2009). "Ubiquitylation on canonical and non-canonical sites targets the transcription factor neurogenin for ubiquitin-mediated proteolysis". The Journal of Biological Chemistry. 284 (23): 15458–68. doi:10.1074/jbc.M809366200. PMC 2708843. PMID 19336407.
  29. ^ a b McDowell GS, Kucerova R, Philpott A (oktobar 2010). "Non-canonical ubiquitylation of the proneural protein Ngn2 occurs in both Xenopus embryos and mammalian cells". Biochemical and Biophysical Research Communications. 400 (4): 655–60. doi:10.1016/j.bbrc.2010.08.122. PMID 20807509.
  30. ^ Tatham MH, Plechanovová A, Jaffray EG, Salmen H, Hay RT (juli 2013). "Ube2W conjugates ubiquitin to α-amino groups of protein N-termini". The Biochemical Journal. 453 (1): 137–45. doi:10.1042/BJ20130244. PMC 3778709. PMID 23560854.
  31. ^ Vittal V, Shi L, Wenzel DM, Scaglione KM, Duncan ED, Basrur V, Elenitoba-Johnson KS, Baker D, Paulson HL, Brzovic PS, Klevit RE (januar 2015). "Intrinsic disorder drives N-terminal ubiquitylation by Ube2w". Nature Chemical Biology. 11 (1): 83–9. doi:10.1038/nchembio.1700. PMC 4270946. PMID 25436519.
  32. ^ Johnson ES, Ma PC, Ota IM, Varshavsky A (juli 1995). "A proteolytic pathway that recognizes ubiquitin as a degradation signal". The Journal of Biological Chemistry. 270 (29): 17442–56. doi:10.1074/jbc.270.29.17442. PMID 7615550.
  33. ^ a b Wang X, Herr RA, Chua WJ, Lybarger L, Wiertz EJ, Hansen TH (maj 2007). "Ubiquitination of serine, threonine, or lysine residues on the cytoplasmic tail can induce ERAD of MHC-I by viral E3 ligase mK3". The Journal of Cell Biology. 177 (4): 613–24. doi:10.1083/jcb.200611063. PMC 2064207. PMID 17502423.
  34. ^ Cadwell K, Coscoy L (juli 2005). "Ubiquitination on nonlysine residues by a viral E3 ubiquitin ligase". Science. 309 (5731): 127–30. Bibcode:2005Sci...309..127C. doi:10.1126/science.1110340. PMID 15994556.
  35. ^ Cadwell K, Coscoy L (april 2008). "The specificities of Kaposi's sarcoma-associated herpesvirus-encoded E3 ubiquitin ligases are determined by the positions of lysine or cysteine residues within the intracytoplasmic domains of their targets". Journal of Virology. 82 (8): 4184–9. doi:10.1128/JVI.02264-07. PMC 2293015. PMID 18272573.
  36. ^ Williams C, van den Berg M, Sprenger RR, Distel B (august 2007). "A conserved cysteine is essential for Pex4p-dependent ubiquitination of the peroxisomal import receptor Pex5p". The Journal of Biological Chemistry. 282 (31): 22534–43. doi:10.1074/jbc.M702038200. PMID 17550898.
  37. ^ Carvalho AF, Pinto MP, Grou CP, Alencastre IS, Fransen M, Sá-Miranda C, Azevedo JE (oktobar 2007). "Ubiquitination of mammalian Pex5p, the peroxisomal import receptor". The Journal of Biological Chemistry. 282 (43): 31267–72. doi:10.1074/jbc.M706325200. PMID 17726030.
  38. ^ Léon S, Subramani S (mart 2007). "A conserved cysteine residue of Pichia pastoris Pex20p is essential for its recycling from the peroxisome to the cytosol". The Journal of Biological Chemistry. 282 (10): 7424–30. doi:10.1074/jbc.M611627200. PMC 3682499. PMID 17209040.
  39. ^ a b Tait SW, de Vries E, Maas C, Keller AM, D'Santos CS, Borst J (decembar 2007). "Apoptosis induction by Bid requires unconventional ubiquitination and degradation of its N-terminal fragment". The Journal of Cell Biology. 179 (7): 1453–66. doi:10.1083/jcb.200707063. PMC 2373500. PMID 18166654.
  40. ^ a b Roark R, Itzhaki L, Philpott A (decembar 2012). "Complex regulation controls Neurogenin3 proteolysis". Biology Open. 1 (12): 1264–72. doi:10.1242/bio.20121750. PMC 3522888. PMID 23259061.
  41. ^ Magadán JG, Pérez-Victoria FJ, Sougrat R, Ye Y, Strebel K, Bonifacino JS (april 2010). "Multilayered mechanism of CD4 downregulation by HIV-1 Vpu involving distinct ER retention and ERAD targeting steps". PLOS Pathogens. 6 (4): e1000869. doi:10.1371/journal.ppat.1000869. PMC 2861688. PMID 20442859.
  42. ^ Tokarev AA, Munguia J, Guatelli JC (januar 2011). "Serine-threonine ubiquitination mediates downregulation of BST-2/tetherin and relief of restricted virion release by HIV-1 Vpu". Journal of Virology. 85 (1): 51–63. doi:10.1128/JVI.01795-10. PMC 3014196. PMID 20980512.
  43. ^ Ishikura S, Weissman AM, Bonifacino JS (juli 2010). "Serine residues in the cytosolic tail of the T-cell antigen receptor alpha-chain mediate ubiquitination and endoplasmic reticulum-associated degradation of the unassembled protein". The Journal of Biological Chemistry. 285 (31): 23916–24. doi:10.1074/jbc.M110.127936. PMC 2911338. PMID 20519503.
  44. ^ Shimizu Y, Okuda-Shimizu Y, Hendershot LM (decembar 2010). "Ubiquitylation of an ERAD substrate occurs on multiple types of amino acids". Molecular Cell. 40 (6): 917–26. doi:10.1016/j.molcel.2010.11.033. PMC 3031134. PMID 21172657.
  45. ^ Dikic I, Robertson M (mart 2012). "Ubiquitin ligases and beyond". BMC Biology. 10: 22. doi:10.1186/1741-7007-10-22. PMC 3305657. PMID 22420755.
  46. ^ Schulman BA, Harper JW (maj 2009). "Ubiquitin-like protein activation by E1 enzymes: the apex for downstream signalling pathways". Nature Reviews Molecular Cell Biology. 10 (5): 319–31. doi:10.1038/nrm2673. PMC 2712597. PMID 19352404.
  47. ^ Groettrup M, Pelzer C, Schmidtke G, Hofmann K (maj 2008). "Activating the ubiquitin family: UBA6 challenges the field". Trends in Biochemical Sciences. 33 (5): 230–7. doi:10.1016/j.tibs.2008.01.005. PMID 18353650.
  48. ^ van Wijk SJ, Timmers HT (april 2010). "The family of ubiquitin-conjugating enzymes (E2s): deciding between life and death of proteins". FASEB Journal. 24 (4): 981–93. doi:10.1096/fj.09-136259. PMID 19940261. S2CID 21280193.
  49. ^ Metzger MB, Hristova VA, Weissman AM (februar 2012). "HECT and RING finger families of E3 ubiquitin ligases at a glance". Journal of Cell Science. 125 (Pt 3): 531–7. doi:10.1242/jcs.091777. PMC 3381717. PMID 22389392.
  50. ^ Skaar JR, Pagano M (decembar 2009). "Control of cell growth by the SCF and APC/C ubiquitin ligases". Current Opinion in Cell Biology. 21 (6): 816–24. doi:10.1016/j.ceb.2009.08.004. PMC 2805079. PMID 19775879.
  51. ^ Pickart CM, Eddins MJ (novembar 2004). "Ubiquitin: structures, functions, mechanisms". Biochimica et Biophysica Acta (BBA) - Molecular Cell Research. 1695 (1–3): 55–72. doi:10.1016/j.bbamcr.2004.09.019. PMID 15571809.
  52. ^ Kerscher O, Felberbaum R, Hochstrasser M (2006). "Modification of proteins by ubiquitin and ubiquitin-like proteins". Annual Review of Cell and Developmental Biology. 22: 159–80. doi:10.1146/annurev.cellbio.22.010605.093503. PMID 16753028.
  53. ^ Koegl M, Hoppe T, Schlenker S, Ulrich HD, Mayer TU, Jentsch S (mart 1999). "A novel ubiquitination factor, E4, is involved in multiubiquitin chain assembly". Cell. 96 (5): 635–44. doi:10.1016/S0092-8674(00)80574-7. PMID 10089879.
  54. ^ Lai Z, Ferry KV, Diamond MA, Wee KE, Kim YB, Ma J, Yang T, Benfield PA, Copeland RA, Auger KR (august 2001). "Human mdm2 mediates multiple mono-ubiquitination of p53 by a mechanism requiring enzyme isomerization". The Journal of Biological Chemistry. 276 (33): 31357–67. doi:10.1074/jbc.M011517200. PMID 11397792.
  55. ^ Grossman SR, Deato ME, Brignone C, Chan HM, Kung AL, Tagami H, Nakatani Y, Livingston DM (april 2003). "Polyubiquitination of p53 by a ubiquitin ligase activity of p300". Science. 300 (5617): 342–4. Bibcode:2003Sci...300..342G. doi:10.1126/science.1080386. PMID 12690203. S2CID 11526100.
  56. ^ Shi D, Pop MS, Kulikov R, Love IM, Kung AL, Kung A, Grossman SR (septembar 2009). "CBP and p300 are cytoplasmic E4 polyubiquitin ligases for p53". Proceedings of the National Academy of Sciences of the United States of America. 106 (38): 16275–80. Bibcode:2009PNAS..10616275S. doi:10.1073/pnas.0904305106. PMC 2752525. PMID 19805293.
  57. ^ Michel MA, Elliott PR, Swatek KN, Simicek M, Pruneda JN, Wagstaff JL, Freund SM, Komander D (april 2015). "Assembly and specific recognition of k29- and k33-linked polyubiquitin". Molecular Cell. 58 (1): 95–109. doi:10.1016/j.molcel.2015.01.042. PMC 4386031. PMID 25752577.
  58. ^ Zhao S, Ulrich HD (april 2010). "Distinct consequences of posttranslational modification by linear versus K63-linked polyubiquitin chains". Proceedings of the National Academy of Sciences of the United States of America. 107 (17): 7704–9. Bibcode:2010PNAS..107.7704Z. doi:10.1073/pnas.0908764107. PMC 2867854. PMID 20385835.
  59. ^ "Ubiquitin Proteasome Pathway Overview". Arhivirano s originala, 30. 3. 2008. Pristupljeno 30. 4. 2008.
  60. ^ Bax, M (juni 2019). "The Ubiquitin Proteasome System Is a Key Regulator of Pluripotent Stem Cell Survival and Motor Neuron Differentiation". Cells. 8 (6): 581. doi:10.3390/cells8060581. PMC 6627164. PMID 31200561.
  61. ^ Nijman SM, Luna-Vargas MP, Velds A, Brummelkamp TR, Dirac AM, Sixma TK, Bernards R (decembar 2005). "A genomic and functional inventory of deubiquitinating enzymes". Cell. 123 (5): 773–86. doi:10.1016/j.cell.2005.11.007. hdl:1874/20959. PMID 16325574. S2CID 15575576.
  62. ^ Hicke L, Schubert HL, Hill CP (august 2005). "Ubiquitin-binding domains". Nature Reviews Molecular Cell Biology. 6 (8): 610–21. doi:10.1038/nrm1701. PMID 16064137. S2CID 3056635.
  63. ^ Husnjak K, Dikic I (1. 1. 2012). "Ubiquitin-binding proteins: decoders of ubiquitin-mediated cellular functions". Annual Review of Biochemistry. 81: 291–322. doi:10.1146/annurev-biochem-051810-094654. PMID 22482907.
  64. ^ Popovic, D (novembar 2014). "Ubiquitination in disease pathogenesis and treatment". Nature Medicine. 20 (11): 1242–1253. doi:10.1038/nm.3739. PMID 25375928. S2CID 205394130.
  65. ^ Tung CW, Ho SY (juli 2008). "Computational identification of ubiquitylation sites from protein sequences". BMC Bioinformatics. 9: 310. doi:10.1186/1471-2105-9-310. PMC 2488362. PMID 18625080.
  66. ^ Radivojac P, Vacic V, Haynes C, Cocklin RR, Mohan A, Heyen JW, Goebl MG, Iakoucheva LM (februar 2010). "Identification, analysis, and prediction of protein ubiquitination sites". Proteins. 78 (2): 365–80. doi:10.1002/prot.22555. PMC 3006176. PMID 19722269.
  67. ^ Chen Z, Chen YZ, Wang XF, Wang C, Yan RX, Zhang Z (2011). Fraternali F (ured.). "Prediction of ubiquitination sites by using the composition of k-spaced amino acid pairs". PLOS ONE. 6 (7): e22930. Bibcode:2011PLoSO...622930C. doi:10.1371/journal.pone.0022930. PMC 3146527. PMID 21829559.

Vanjski linkovi[uredi | uredi izvor]

Šablon:Proteinska posttranslacijska modifikacija Šablon:Posttranslacijska modifikacija