Idi na sadržaj

KCNQ3

S Wikipedije, slobodne enciklopedije
KCNQ3
Identifikatori
AliasiKCNQ3
Vanjski ID-jeviOMIM: 602232 MGI: 1336181 HomoloGene: 20949 GeneCards: KCNQ3
Lokacija gena (čovjek)
Hromosom 8 (čovjek)
Hrom.Hromosom 8 (čovjek)[1]
Hromosom 8 (čovjek)
Genomska lokacija za KCNQ3
Genomska lokacija za KCNQ3
Bend8q24.22Početak132,120,859 bp[1]
Kraj132,481,095 bp[1]
Lokacija gena (miš)
Hromosom 15 (miš)
Hrom.Hromosom 15 (miš)[2]
Hromosom 15 (miš)
Genomska lokacija za KCNQ3
Genomska lokacija za KCNQ3
Bend15 D1|15 29.16 cMPočetak65,858,236 bp[2]
Kraj66,158,491 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija voltage-gated ion channel activity
ion channel activity
voltage-gated potassium channel activity
potassium channel activity
calmodulin binding
GO:0001948, GO:0016582 vezivanje za proteine
delayed rectifier potassium channel activity
Ćelijska komponenta membrana
ćelijska membrana
Ranvijerov čvor
cell surface
axon initial segment
integral component of membrane
integral component of plasma membrane
voltage-gated potassium channel complex
Biološki proces membrane hyperpolarization
regulation of ion transmembrane transport
ion transport
transmembrane transport
chemical synaptic transmission
potassium ion transport
potassium ion transmembrane transport
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001204824
NM_004519

NM_152923

RefSeq (bjelančevina)

NP_001191753
NP_004510

NP_690887

Lokacija (UCSC)Chr 8: 132.12 – 132.48 MbChr 15: 65.86 – 66.16 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Kv7.3 (KvLQT3) je protein kalijevog kanala koji je kod ljudi kodiran genom KCNQ3.[5]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 872 aminokiseline, а molekulska težina Da. 96 742[6]

1020304050
MGLKARRAAGAAGGGGDGGGGGGGAANPAGGDAAAAGDEERKVGLAPGDV
EQVTLALGAGADKDGTLLLEGGGRDEGQRRTPQGIGLLAKTPLSRPVKRN
NAKYRRIQTLIYDALERPRGWALLYHALVFLIVLGCLILAVLTTFKEYET
VSGDWLLLLETFAIFIFGAEFALRIWAAGCCCRYKGWRGRLKFARKPLCM
LDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRMLRMDRRGGTWKLL
GSAICAHSKELITAWYIGFLTLILSSFLVYLVEKDVPEVDAQGEEMKEEF
ETYADALWWGLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAGI
LGSGLALKVQEQHRQKHFEKRRKPAAELIQAAWRYYATNPNRIDLVATWR
FYESVVSFPFFRKEQLEAASSQKLGLLDRVRLSNPRGSNTKGKLFTPLNV
DAIEESPSKEPKPVGLNNKERFRTAFRMKAYAFWQSSEDAGTGDPMAEDR
GYGNDFPIEDMIPTLKAAIRAVRILQFRLYKKKFKETLRPYDVKDVIEQY
SAGHLDMLSRIKYLQTRIDMIFTPGPPSTPKHKKSQKGSAFTFPSQQSPR
NEPYVARPSTSEIEDQSMMGKFVKVERQVQDMGKKLDFLVDMHMQHMERL
QVQVTEYYPTKGTSSPAEAEKKEDNRYSDLKTIICNYSETGPPEPPYSFH
QVTIDKVSPYGFFAHDPVNLPRGGPSSGKVQATPPSSATTYVERPTVLPI
LTLLDSRVSCHSQADLQGPYSDRISPRQRRSITRDSDTPLSLMSVNHEEL
ERSPSGFSISQDRDDYVFGPNGGSSWMREKRYLAEGETDTDTDPFTPSGS
MPLSSTGDGISDSVWTPSNKPI

Funkcija[uredi | uredi izvor]

M kanal je polahko aktivirajući i deaktivirajući kalijev kanal koji ima ključnu ulogu u regulaciji neuronske ekscitabilnosti. Nastaje asocijacijom proteina kodiranog ovim genom i jednog od dva srodna proteina kodirana genima KCNQ2 i KCNQ5, oba integralna membranska proteina. Strujanje M kanala inhibira M1 muskarinske acetilholinske receptore i aktivira retigabin, novi lijek protiv konvulzija. Mahane ovog gena uzrok su benignih porodičnih neonatusnih konvulzija tipa 2 (BFNC2), poznatih i kao epilepsija, benignog neonatusog tipa 2 (EBN2).[5]

Interakcije[uredi | uredi izvor]

KvLQT3 je pokazao da stupa u interakcije sa KCNQ5.[7]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000184156 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000056258 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b "Entrez Gene: KCNQ3 potassium voltage-gated channel, KQT-like subfamily, member 3".
  6. ^ "UniProt, O43525" (jezik: engleski). Pristupljeno 19. 9. 2021.
  7. ^ Yus-Nájera, E; Muñoz A; Salvador N; Jensen B S; Rasmussen H B; Defelipe J; Villarroel A (2003). "Localization of KCNQ5 in the normal and epileptic human temporal neocortex and hippocampal formation". Neuroscience. 120 (2): 353–64. doi:10.1016/S0306-4522(03)00321-X. ISSN 0306-4522. PMID 12890507. S2CID 38381189.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.