SCNN1A

S Wikipedije, slobodne enciklopedije
SCNN1A
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2M3O

Identifikatori
AliasiSCNN1A
Vanjski ID-jeviOMIM: 600228 MGI: 101782 HomoloGene: 811 GeneCards: SCNN1A
Lokacija gena (čovjek)
Hromosom 12 (čovjek)
Hrom.Hromosom 12 (čovjek)[1]
Hromosom 12 (čovjek)
Genomska lokacija za SCNN1A
Genomska lokacija za SCNN1A
Bend12p13.31Početak6,346,843 bp[1]
Kraj6,377,730 bp[1]
Lokacija gena (miš)
Hromosom 6 (miš)
Hrom.Hromosom 6 (miš)[2]
Hromosom 6 (miš)
Genomska lokacija za SCNN1A
Genomska lokacija za SCNN1A
Bend6 F3|6 59.32 cMPočetak125,297,622 bp[2]
Kraj125,321,906 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija sodium channel activity
GO:0001948, GO:0016582 protein binding
ligand-gated sodium channel activity
WW domain binding
Ćelijska komponenta integral component of membrane
projekcija ćelije
membrana
sodium channel complex
integral component of plasma membrane
Treplja
ciliary membrane
Egzosom
Ćelijska membrana
apical plasma membrane
citoplazma
sperm principal piece
Akrozom
GO:0016023 citoplazmatska vezikula
motile cilium
Biološki proces sodium ion transmembrane transport
response to stimulus
sodium ion transport
ion transport
sodium ion homeostasis
multicellular organismal water homeostasis
sensory perception of taste
ion transmembrane transport
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001159576
NM_001038
NM_001159575

NM_011324

RefSeq (bjelančevina)

NP_001029
NP_001153047
NP_001153048

NP_035454
NP_001392957
NP_001392960

Lokacija (UCSC)Chr 12: 6.35 – 6.38 MbChr 6: 125.3 – 125.32 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

SCNN1A je ljudaki gen sa hromosoma 12, kiji kodira α podjedinicu epitelnog natrijevog kanala ENaC u kičmenjacima. ENaC je sastavljen kao heterotrimer od tri homologne podjedinice α, β i γ ili δ, β i γ.[5] Ostale ENAC podjedinice su kodirane pomoću SCNN1B, SCNN1G i SCNN1D.

ENaC se eksprimira u epitelnim ćelijama[5] i razlikuje se od naponskog natrijevog kanala koji je uključen u stvaranje akcijskih potencijala u neuronima. Skraćenica za gene koji kodiraju za voltazijski natrijski kanal počinje sa tri slova: SCN. Za razliku od ovih natrijevih kanala, ENaC je konstitutivno aktivan i ne zavisi od napona. Drugo N u skraćenici (SCNN1A) predstavlja da se radi o kanalima koji nisu naponski.

Kod većine kičmenjaka, ioni natrijuma su glavna determinanta osmolarnosti vanćelijake tečnosti.[6] ENaC omogućava transfer iona natrija preko ćelijske membrane u epitelu u takozvanim "zategnutim epitelima" koji imaju nisku permeabilnost. Protok iona natrija epitel utiče na osmolarnost ekstracelularne tečnosti. Dakle, ENaC igra centralnu ulogu u regulaciji putem homeostaze tjelesnih tekućina i elektrolita i posljedično utiče na krvni pritisak.[7]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 669 aminokiselina, a molekulska težina 75.704 Da.[5]

1020304050
MEGNKLEEQDSSPPQSTPGLMKGNKREEQGLGPEPAAPQQPTAEEEALIE
FHRSYRELFEFFCNNTTIHGAIRLVCSQHNRMKTAFWAVLWLCTFGMMYW
QFGLLFGEYFSYPVSLNINLNSDKLVFPAVTICTLNPYRYPEIKEELEEL
DRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGA
RRARSVASSLRDNNPQVDWKDWKIGFQLCNQNKSDCFYQTYSSGVDAVRE
WYRFHYINILSRLPETLPSLEEDTLGNFIFACRFNQVSCNQANYSHFHHP
MYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQNDFIPLLSTVTGAR
VMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSD
VPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQNVEYCDYRKH
SSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRWPSVTSQE
WVFQMLSRQNNYTVNNKRNGVAKVNIFFKELNYKTNSESPSVTMVTLLSN
LGSQWSLWFGSSVLSVVEMAELVFDLLVIMFLMLLRRFRSRYWSPGRGGR
GAQEVASTLASSPPSHFCPHPMSLSLSQPGPAPSPALTAPPPAYATLGPR
PSPGGSAGASSSTCPLGGP

Interakcije[uredi | uredi izvor]

Pokazalo se da SCNN1A interraguje sa:

Također pogledajte[uredi | uredi izvor]


Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000111319 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000030340 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b c Hanukoglu I, Hanukoglu A (april 2016). "Epithelial sodium channel (ENaC) family: Phylogeny, structure-function, tissue distribution, and associated inherited diseases". Gene. 579 (2): 95–132. doi:10.1016/j.gene.2015.12.061. PMC 4756657. PMID 26772908.
  6. ^ Bourque CW (juli 2008). "Central mechanisms of osmosensation and systemic osmoregulation". Nature Reviews. Neuroscience. 9 (7): 519–31. doi:10.1038/nrn2400. PMID 18509340. S2CID 205504313.
  7. ^ Rossier BC, Baker ME, Studer RA (januar 2015). "Epithelial sodium transport and its control by aldosterone: the story of our internal environment revisited". Physiological Reviews. 95 (1): 297–340. doi:10.1152/physrev.00011.2014. PMID 25540145.
  8. ^ a b Harvey KF, Dinudom A, Cook DI, Kumar S (mart 2001). "The Nedd4-like protein KIAA0439 is a potential regulator of the epithelial sodium channel". The Journal of Biological Chemistry. 276 (11): 8597–601. doi:10.1074/jbc.C000906200. PMID 11244092.
  9. ^ Malbert-Colas L, Nicolas G, Galand C, Lecomte MC, Dhermy D (juli 2003). "Identification of new partners of the epithelial sodium channel alpha subunit". Comptes Rendus Biologies. 326 (7): 615–24. doi:10.1016/s1631-0691(03)00154-9. PMID 14556380.
  10. ^ Farr TJ, Coddington-Lawson SJ, Snyder PM, McDonald FJ (februar 2000). "Human Nedd4 interacts with the human epithelial Na+ channel: WW3 but not WW1 binds to Na+-channel subunits". The Biochemical Journal. 345 Pt 3 (3): 503–9. doi:10.1042/0264-6021:3450503. PMC 1220784. PMID 10642508.
  11. ^ McDonald FJ, Western AH, McNeil JD, Thomas BC, Olson DR, Snyder PM (septembar 2002). "Ubiquitin-protein ligase WWP2 binds to and downregulates the epithelial Na(+) channel". American Journal of Physiology. Renal Physiology. 283 (3): F431–6. doi:10.1152/ajprenal.00080.2002. PMID 12167593.
  12. ^ Boulkroun S, Ruffieux-Daidié D, Vitagliano JJ, Poirot O, Charles RP, Lagnaz D, Firsov D, Kellenberger S, Staub O (oktobar 2008). "Vasopressin-inducible ubiquitin-specific protease 10 increases ENaC cell surface expression by deubiquitylating and stabilizing sorting nexin 3". American Journal of Physiology. Renal Physiology. 295 (4): F889–900. doi:10.1152/ajprenal.00001.2008. PMID 18632802.
  13. ^ Raikwar NS, Thomas CP (maj 2008). "Nedd4-2 isoforms ubiquitinate individual epithelial sodium channel subunits and reduce surface expression and function of the epithelial sodium channel". American Journal of Physiology. Renal Physiology. 294 (5): F1157–65. doi:10.1152/ajprenal.00339.2007. PMC 2424110. PMID 18322022.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]