Idi na sadržaj

GJB6

S Wikipedije, slobodne enciklopedije
GJB6
Identifikatori
AliasiGJB6
Vanjski ID-jeviOMIM: 604418 MGI: 107588 HomoloGene: 4936 GeneCards: GJB6
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za GJB6
Genomska lokacija za GJB6
Bend13q12.11Početak20,221,962 bp[1]
Kraj20,232,365 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za GJB6
Genomska lokacija za GJB6
Bend14 C3|14 30.1 cMPočetak57,360,760 bp[2]
Kraj57,371,068 bp[2]
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_006783
NM_001110219
NM_001110220
NM_001110221
NM_001370090

NM_001370091
NM_001370092

NM_001010937
NM_001271663
NM_008128

RefSeq (bjelančevina)
NP_001103689
NP_001103690
NP_001103691
NP_006774
NP_001357019

NP_001357020
NP_001357021

NP_001010937
NP_001258592

Lokacija (UCSC)Chr 13: 20.22 – 20.23 MbChr 14: 57.36 – 57.37 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Međuprostorni vezni protein beta-6 (GJB6), znan i kao koneksin 30 (Cx30) — je protein koji je kod ljudi kodiran genom GJB6.[5][6][7] Koneksin 30 (Cx30) je jedan od nekoliko spojnih proteina za uspostavljenje međućelijskih veza koji se eksprimira u unutrašnjem uhu.[8] Utvrđeno je da mutacije u genima za ove veze dovode i do sindromske i do nesindromske gluhoće.[9] Mutacije u ovom genu povezane su s Cloustonovim sindromom (tj. hidrotskom ektodermnom displazijom).

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 261 aminokiselina, a molekulska težina — 30.387 Da.[10]

1020304050
MDWGTLHTFIGGVNKHSTSIGKVWITVIFIFRVMILVVAAQEVWGDEQED
FVCNTLQPGCKNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRH
ETTRKFRRGEKRNDFKDIEDIKKQKVRIEGSLWWTYTSSIFFRIIFEAAF
MYVFYFLYNGYHLPWVLKCGIDPCPNLVDCFISRPTEKTVFTIFMISASV
ICMLLNVAELCYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISD
SGQNAITGFPS
Simboli

Funkcija[uredi | uredi izvor]

Pukotinske (lijevo, sa koneksinom) i neki primjeri ostallih međućelijdkih veza

Porodica koneksinskih gena kodira proteinske podjedinice kanala koji spajaju pukotinske međućelijske veze i posreduju u direktnoj difuziji iona i metabolita između citoplazmi susjednih ćelija. Koneksini obuhvataju plazmamembranu četiri puta (vidi sliku), a amino– i karboksi-terminalne regije okrenute su prema citoplazmi. Koneksinski geni eksprimiraju se na specifičan način za ćelijski tip sa preklapajućom specifičnošću. Spojni kanali s razmakom imaju jedinstvena svojstva, ovisno o tipu koneksina koji čine kanal (prema OMIM-u).[7]

Koneksin 30 je rasprostranjen u dva različita sistema spajanja razmaka, koji se nalaze u pužnicama: mreža spoja epitelnih pukotinskih međućelijskih veza koja spaja nesenzorne epitelne ćelije i mreža uskih spojevaa u vezivno tkivo, koja spaja ćelije vezivnog tkiva. Uske veze služe važnoj svrsi recikliranja kalijevih iona koji prolaze kroz trepljaste ćelije tokom mehanotransdukcije nazad u endolimfu.[11]

Koneksin 30 je kolokaliziran s koneksinom 26.[12] Utvrđeno je da Cx30 i Cx26 tvore heteromerne i heterotipske kanale. Biohemijska svojstva i propusnost ovih složenijih kanala razlikuju se od homotipskih kanala Cx30 ili Cx26.[13] Prekomjerna ekspresija Cx30 u null miševima Cx30 obnovila je ekspresiju Cx26, funkcioniranje kanala normalnog razmaka i signalizaciju kalcija, ali je u nul miševa Cx30 ekspresija Cx26 promijenjena. Pretpostavlja se da koregulacija Cx26 i Cx30 ovisi o signalizaciji fosfolipaze C i NF-κB putu.[14]

Pužnica sadrži dva tipa ćelija, slušne trepljaste ćelije za mehanotransdukciju i potporne ćelije. Kanali međuprostornog spajanja nalaze se samo između ćelija koje podržavaju pužnicu.[15] Dok su pukotinske međućelijske veze u unutrašnjem uhu kritično uključene u recikliranje kalija u endolimfi, ekspresija koneksina u potpornim ćelijamama koje okružuju Cortijev organ podupire oporavak lezija epitelnog tkiva nakon gubitka čulnih treplastih ćelija. Eksperiment sa nul miševima Cx30 otkrio je nedostatke u zatvaranju lezija i popravku Cortijevog organa nakon gubitka trepljastih ćelija, što ukazuje da Cx30 ima ulogu u regulaciji odgovora na popravak lezija.[16]

Klinički značaj[uredi | uredi izvor]

Slušni[uredi | uredi izvor]

Koneksin 26 i koneksin 30 općenito su prihvaćeni kao proteini spojeva koji prevladavaju u pužnicama. Eksperimenti s genetičkim nokaut-miševima pokazali su da nokaut ili Cx26 ili Cx30 proizvodi gluhoću.[17][18] Međutim, novija istraživanja sugeriraju da nokaut Cx30 proizvodi gluhoću zbog kasnije regulacije Cx26, a jedno je istraživanje na mišu pokazalo da je mutacija Cx30 koja čuva polovinu ekspresije Cx26 pronađena u normalnih miševa Cx30 rezultirala nesmetanim sluhom.[19] Smanjena ozbiljnost nokauta Cx30 u usporedbi s nokautom Cx26 potkrijepljena je studijom koja je ispitivala vremenski tok i obrasce degeneracije trepljastih ćelija u pužnici. Nx miševi Cx26 pokazali su bržu i raširenu ćelijsku smrt od nultih miševa Cx30. Postotak gubitka trepljastih ćelija bio je manje rasprostranjen i učestao u pužnici null miševa Cx30.[20]

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000121742 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000040055 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Grifa A, Wagner CA, D'Ambrosio L, Melchionda S, Bernardi F, Lopez-Bigas N, Rabionet R, Arbones M, Monica MD, Estivill X, Zelante L, Lang F, Gasparini P (septembar 1999). "Mutations in GJB6 cause nonsyndromic autosomal dominant deafness at DFNA3 locus". Nature Genetics. 23 (1): 16–8. doi:10.1038/12612. PMID 10471490.
  6. ^ Kibar Z, Der Kaloustian VM, Brais B, Hani V, Fraser FC, Rouleau GA (april 1996). "The gene responsible for Clouston hidrotic ectodermal dysplasia maps to the pericentromeric region of chromosome 13q". Human Molecular Genetics. 5 (4): 543–7. doi:10.1093/hmg/5.4.543. PMID 8845850.
  7. ^ a b "Entrez Gene: GJB6 gap junction protein, beta 6".
  8. ^ Zhao HB, Kikuchi T, Ngezahayo A, White TW (2006). "Gap junctions and cochlear homeostasis". The Journal of Membrane Biology. 209 (2–3): 177–86. doi:10.1007/s00232-005-0832-x. PMC 1609193. PMID 16773501.
  9. ^ Erbe CB, Harris KC, Runge-Samuelson CL, Flanary VA, Wackym PA (april 2004). "Connexin 26 and connexin 30 mutations in children with nonsyndromic hearing loss". The Laryngoscope. 114 (4): 607–11. doi:10.1097/00005537-200404000-00003. PMID 15064611.
  10. ^ "UniProt, O95452". Pristupljeno 11. 9. 2017.
  11. ^ Kikuchi T, Kimura RS, Paul DL, Takasaka T, Adams JC (april 2000). "Gap junction systems in the mammalian cochlea". Brain Research. Brain Research Reviews. 32 (1): 163–6. doi:10.1016/S0165-0173(99)00076-4. PMID 10751665.
  12. ^ Lautermann J, ten Cate WJ, Altenhoff P, Grümmer R, Traub O, Frank H, Jahnke K, Winterhager E (decembar 1998). "Expression of the gap-junction connexins 26 and 30 in the rat cochlea". Cell and Tissue Research. 294 (3): 415–20. doi:10.1007/s004410051192. PMID 9799458.
  13. ^ Yum SW, Zhang J, Valiunas V, Kanaporis G, Brink PR, White TW, Scherer SS (septembar 2007). "Human connexin26 and connexin30 form functional heteromeric and heterotypic channels". American Journal of Physiology. Cell Physiology. 293 (3): C1032-48. doi:10.1152/ajpcell.00011.2007. PMID 17615163.
  14. ^ Ortolano S, Di Pasquale G, Crispino G, Anselmi F, Mammano F, Chiorini JA (decembar 2008). "Coordinated control of connexin 26 and connexin 30 at the regulatory and functional level in the inner ear". Proceedings of the National Academy of Sciences of the United States of America. 105 (48): 18776–81. doi:10.1073/pnas.0800831105. PMC 2596232. PMID 19047647.
  15. ^ Kikuchi T, Kimura RS, Paul DL, Adams JC (februar 1995). "Gap junctions in the rat cochlea: immunohistochemical and ultrastructural analysis". Anatomy and Embryology. 191 (2): 101–18. doi:10.1007/BF00186783. PMID 7726389.
  16. ^ Forge A, Jagger DJ, Kelly JJ, Taylor RR (april 2013). "Connexin30-mediated intercellular communication plays an essential role in epithelial repair in the cochlea" (PDF). Journal of Cell Science. 126 (Pt 7): 1703–12. doi:10.1242/jcs.125476. PMID 23424196.
  17. ^ Teubner B, Michel V, Pesch J, Lautermann J, Cohen-Salmon M, Söhl G, Jahnke K, Winterhager E, Herberhold C, Hardelin JP, Petit C, Willecke K (januar 2003). "Connexin30 (Gjb6)-deficiency causes severe hearing impairment and lack of endocochlear potential". Human Molecular Genetics. 12 (1): 13–21. doi:10.1093/hmg/ddg001. PMID 12490528.
  18. ^ Kudo T, Kure S, Ikeda K, Xia AP, Katori Y, Suzuki M, Kojima K, Ichinohe A, Suzuki Y, Aoki Y, Kobayashi T, Matsubara Y (maj 2003). "Transgenic expression of a dominant-negative connexin26 causes degeneration of the organ of Corti and non-syndromic deafness". Human Molecular Genetics. 12 (9): 995–1004. doi:10.1093/hmg/ddg116. PMID 12700168.
  19. ^ Boulay AC, del Castillo FJ, Giraudet F, Hamard G, Giaume C, Petit C, Avan P, Cohen-Salmon M (januar 2013). "Hearing is normal without connexin30". The Journal of Neuroscience. 33 (2): 430–4. doi:10.1523/JNEUROSCI.4240-12.2013. PMID 23303923.
  20. ^ Sun Y, Tang W, Chang Q, Wang Y, Kong W, Lin X (oktobar 2009). "Connexin30 null and conditional connexin26 null mice display distinct pattern and time course of cellular degeneration in the cochlea". The Journal of Comparative Neurology. 516 (6): 569–79. doi:10.1002/cne.22117. PMC 2846422. PMID 19673007.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]