GCDH

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
GCDH
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1SIQ, 1SIR, 2R0M, 2R0N

Identifikatori
AliasiGCDH
Vanjski ID-jeviOMIM: 608801 MGI: 104541 HomoloGene: 130 GeneCards: GCDH
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za GCDH
Genomska lokacija za GCDH
Bend19p13.13Početak12,891,160 bp[1]
Kraj12,914,207 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za GCDH
Genomska lokacija za GCDH
Bend8 C3|8 41.28 cMPočetak84,886,393 bp[2]
Kraj84,893,921 bp[2]
Ontologija gena
Molekularna funkcija oxidoreductase activity, acting on the CH-CH group of donors
acyl-CoA dehydrogenase activity
oxidoreductase activity
glutaryl-CoA dehydrogenase activity
fatty-acyl-CoA binding
flavin adenine dinucleotide binding
glutaryl-CoA hydrolase activity
Ćelijska komponenta mitochondrial matrix
mitohondrija
Biološki proces fatty-acyl-CoA biosynthetic process
tryptophan metabolic process
acyl-CoA metabolic process
fatty acid oxidation
lysine catabolic process
fatty acid beta-oxidation using acyl-CoA dehydrogenase
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000159
NM_013976

NM_001044744
NM_008097

RefSeq (bjelančevina)

NP_000150
NP_039663

NP_001038209
NP_032123

Lokacija (UCSC)Chr 19: 12.89 – 12.91 MbChr 8: 84.89 – 84.89 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Glutaril-CoA dehidrogenaza (dekarboksilirajuća)
Identifikatori
SimbolGCDH
CAS broj37255-38-2

Glutaril-CoA dehidrogenaza (GCDH) je enzim koji je kod ljudi kodiran genom GCDH sa hromosma 19. Protein pripada porodici acil-CoA dehidrogenaza (ACD). Katalizira oksidativno dekarboksiliranje glutaral-CoA do krotonil-CoA i ugljen-dioksida u degradacijskom putu metabolizma L-lizina, L-hdroksilizina i L-triptofana. Kao svoj akceptorski elektron koristi flavoprotein za prenos elektrona. Enzim postoji u mitohondrijskoj matrici kao homotetramerna podjedinica od 45 - kD. Mutacije ovog gena rezultiraju metaboličkim poremećajem glutarna acidurija tip 1, koji je poznat i kao glutarna acidemija tip I. Alternativna prerada ovog gena rezultira višestrukim varijantama transkripta.[5]

Struktura[uredi | uredi izvor]

GCDH je tetramer sa tetraedarskom simetrijom, što omogućava da se na njega gleda kao na dimer dimera. Njegova struktura je vrlo slična ostalim ACD-ima, ali ukupni polipeptidni nabor GCDH sastoji se od tri domena: alfa-heliksni snop domena amino-kraj , domen beta-lista u sredini i još jedan domen alfa-heliksa na karboksilnom kraju. Flavin adenin dinukleotid (FAD) nalazi se na spoju između srednjeg beta-lanca i karboksilnog terminalnog alfa-heliksnog domena jedne podjedinice i karboksil-terminalnog domena susedne podjedinice. Najizrazitija razlika između GCDH i ostalih ACD-a u pogledu strukture je karboksilna i amino-terminalna regija monomera i u petlji između beta-lanaca 4 i 5, jer se sastoji od samo četiri ostatka, dok ostali ACD imaju mnogo više. Džep koji veže supstrat ispunjen je nizom od tri molekule vode, koje se pomjeraju kada se supstrat veže za enzim. Džep za vezanje je također manji od nekih drugih džepova za vezivanje ACD-a jer je odgovoran za specifičnost dužine lanca GCDH za zamjenske podloge.[6] The GCDH gene is mapped onto 19p13.2 and has an exon count of 15.[7]

Aminokiselinska sekvenca[uredi | uredi izvor]

1020304050
MALRGVSVRLLSRGPGLHVLRTWVSSAAQTEKGGRTQSQLAKSSRPEFDW
QDPLVLEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEM
GELGVLGPTIKGYGCAGVSSVAYGLLARELERVDSGYRSAMSVQSSLVMH
PIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRAHYNSS
NKSYTLNGTKTWITNSPMADLFVVWARCEDGCIRGFLLEKGMRGLSAPRI
QGKFSLRASATGMIIMDGVEVPEENVLPGASSLGGPFGCLNNARYGIAWG
VLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHAC
LQLGRLKDQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHV
IRHAMNLEAVNTYEGTHDIHALILGRAITGIQAFTASK
Simboli

Funkcija[uredi | uredi izvor]

GCDH je uglavnom poznat po oksidativnoj dekarboksilaciji glutaril-CoA u krotonil-CoA i ugljik-dioksid, što je uobičajeno u mitohondrijskoj oksidaciji lizina, triptofana i hidroksilizina. To se odvija putem fizičkih, hemijskih i koraka prenosa elektrona. Prvo veže glutaril-CoA supstrat za oksidirani oblik enzima i apstrahira alfa-proton supstrata, katalitskom bazom Glu370. Hidrid se zatim prenosi iz beta-ugljik supstrata u N (5) FAD, dajući 2e smanjeni oblik FAD. Dakle, ovo omogućava dekarboksilaciju glutakonil-CoA, enzima vezanog intermedijara, razbijanjem veze Cγ-Cδ, što rezultira stvaranjem dienolatnog aniona, protona i CO2. Intermedijer dienolata je protoniran, što rezultira krotonil-CoA i oslobađanjem proizvoda s aktivnog mjesta. Konačno, 2e redukovani oblik FAD-a oksidira se u dva 1e koraka putem eksternog akceptora za završetak prometa.[8]

Klinički značaj[uredi | uredi izvor]

Mutacije u GCDH genu mogu dovesti do oštećenja enzima koga kodiraju, što izaziva stvaranje i akumulacije+u metabolita glutarne i 3-hidroksiglutarne kiseline, kao i glutarilkarnitina u tjelesnim tečnostima, što u suštini dovodi do glutarske acidurije tipa I, autosomno recesivnog metaboličkog poremećaja. Simptomi ove bolesti uključuju: makrocefaliju, akutni krize slične encefalitisu, spazme, distoniju, koreoatetozu, ataksiju, diskineziju i napade, koji i prevladavaju na svakih 100.000 osoba.[7] Mutacije na karboksilnom, C-terminalu GCDH najviše su identificirane kod pacijenata sa glutarnom acidurijom tipa I; tačnije, čini se da su mutacije u Ala389Val, Ala389Glu, Thr385Met, Ala377Val i Ala377Thr povezane s poremećajem, jer se disociraju na neaktivne monomere i/ili dimere.[6]

Interakcije[uredi | uredi izvor]

Uočeno je da GCDH ima komunikacije sa:

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000105607 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000003809 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "GCDH glutaryl-CoA dehydrogenase [ Homo sapiens (human) ]". NCBI. Pristupljeno 6. 8. 2015.
  6. ^ a b Fu Z, Wang M, Paschke R, Rao KS, Frerman FE, Kim JJ (august 2004). "Crystal structures of human glutaryl-CoA dehydrogenase with and without an alternate substrate: structural bases of dehydrogenation and decarboxylation reactions". Biochemistry. 43 (30): 9674–84. doi:10.1021/bi049290c. PMID 15274622.
  7. ^ a b Georgiou T, Nicolaidou P, Hadjichristou A, Ioannou R, Dionysiou M, Siama E, Chappa G, Anastasiadou V, Drousiotou A (septembar 2014). "Molecular analysis of Cypriot patients with Glutaric aciduria type I: identification of two novel mutations". Clinical Biochemistry. 47 (13–14): 1300–5. doi:10.1016/j.clinbiochem.2014.06.017. PMID 24973495.
  8. ^ Rao KS, Albro M, Dwyer TM, Frerman FE (decembar 2006). "Kinetic mechanism of glutaryl-CoA dehydrogenase". Biochemistry. 45 (51): 15853–61. doi:10.1021/bi0609016. PMID 17176108.

Vanjski linkovi[uredi | uredi izvor]

Šablon:Enzimi metabolizma aminokiselina