SHBG

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
SHBG
1d2s SHBG.png
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1LHW, 1D2S, 1F5F, 1KDK, 1KDM, 1LHN, 1LHO, 1LHU, 1LHV

Identifikatori
AliasiSHBG
Vanjski ID-jeviOMIM: 182205 MGI: 98295 HomoloGene: 813 GeneCards: SHBG
Lokacija gena (čovjek)
Hromosom 17 (čovjek)
Hrom.Hromosom 17 (čovjek)[1]
Hromosom 17 (čovjek)
Genomska lokacija za SHBG
Genomska lokacija za SHBG
Bend17p13.1Početak7,613,946 bp[1]
Kraj7,633,382 bp[1]
Lokacija gena (miš)
Hromosom 11 (miš)
Hrom.Hromosom 11 (miš)[2]
Hromosom 11 (miš)
Genomska lokacija za SHBG
Genomska lokacija za SHBG
Bend11 B3|11 42.86 cMPočetak69,614,804 bp[2]
Kraj69,617,905 bp[2]
Obrazac RNK ekspresije
PBB GE SHBG 215689 s at fs.png
Više referentnih podataka o ekspresiji
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_001040
NM_001146279
NM_001146280
NM_001146281
NM_001289113

NM_001289114
NM_001289115
NM_001289116

NM_011367

RefSeq (bjelančevina)
NP_001031
NP_001139751
NP_001139752
NP_001139753
NP_001276042

NP_001276043
NP_001276044
NP_001276045

NP_035497

Lokacija (UCSC)Chr 17: 7.61 – 7.63 MbChr 11: 69.61 – 69.62 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Spolnohormonski vezani globulin (SHBG) ili spolnosteroidno-vezani globulin (SSBG) je glikoprotein koji se veže za androgene i estrogene. Ostali steroidni hormoni, kao što su progesteron, kortizol i drugi kortikosteroidi vezani su transkortinom. SHBG se nalazi u svih kičmenjaka, osim u ptica.[5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 402 aminokiseline, a molekulska težina 43.779 Da.[6].

Simboli
1020304050
MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNG
PGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGL
RDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEV
LRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWL
DKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAF
SLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPL
VLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLG
ALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDA
SH

Funkcija[uredi | uredi izvor]

Testosteron i estradiol cirkuliraju u krvotoku, labavo vezani uglavnom za serumski albumin (~ 54%), a u manjoj mjeri čvrsto vezani za SHBG (~ 44%). Samo vrlo mali udio od oko 1 – 2% je nevezan ili "slobodan", te je samim tim biološki aktivan i sposoban ući u ćelije i aktivirati svoj [[receptor (biohemija)|receptor] ]. SHBG inhibira funkciju ovih hormona. Dakle, na bioraspoloživost spolnih hormona utiče nivo SHBG. Relativni afinitet vezivanja različitih spolnih steroida za SHBG je u pravcu dihidrotestosteron (DHT) > testosteron > androstenediol > estradiol > estron.[7] DHT se veže za SHBG s oko 5 puta afinitetom testosterona i oko 20  puta afinitetom estradiola.[8] Dehidroepiandrosteron (DHEA) slabo je vezan za SHBG, ali dehidroepiandrosteron-sulfat nije vezan za SHBG.[7] Androstenedione nije vezan ni za SHBG, već je vezan isključivo za albumin.[9] Estron-sulfat i estriol također su slabo vezani za SHBG.[10] Za SHBG vezano je Manje od 1% progesterona.[11]

Nivo SHBG obično je oko dva puta veći kod žena nego kod muškaraca. Kod žena SHBG služi za ograničavanje izloženosti i androgenima i estrogenima.[8] Nizak nivo SHBG u žena povezan je sa hiperandrogenizmom i rakom endometrija, zbog pojačane izloženosti androgenima, odnosno estrogenima.[8] Tokom trudnoća, zbog aktivacije proizvodnje SHBG u jetri visokim nivoom estrogena, nivoi SHBG povećavaju se pet do deset puta.[8] Visoki nivoi SHBG tokom trudnoće mogu služe za zaštitu majke od izloženosti fetusnim androgenima koji u metabolizmu izlaze iz placenti.[8] A prikaz slučaja teškog hiperandrogenizma u trudnice zbog rijetkog oblika genetičkog nedostatka SHBG to ilustrira.[8][12]

Biosinteza[uredi | uredi izvor]

SHBG uglavnom proizvodi jetra i oslobađa ga u krvotok. Ostala mjesta koja proizvode SHBG uključuju mozak, maternicu, testise i posteljicu. SHBG proizveden iz testisa naziva se androgen-vezujući protein.

Gen[uredi | uredi izvor]

Gen za SHBG naziva se Shbg, koji se nalazi na hromosomu 17[13] na kratkom kraku između opsega 17p12 → p13.[14] Preklapajući na komplementarnom lancu DNK je gen za člana porodice 2 spermidina/spermina N1-acetiltransferaze ([[[SAT2]]). U blizini su geni za p53 i ATP1B2 i mentalna retardacija fragilnog X, autosomni homolog 2 (FXR2) na komplementarnom lancu.[15] Postoji osam [[egzon] ]a, od kojih egzon 1 ima tri varijacije nazvane 1L, 1T i 1N, koje pokreću tri promotora: PL, PT i PN. SHBG dolazi s 1L, 2, 3, 4, 5, 6, 7 i 8 egzona, povezanih zajedno. Varijacija uključuje SHBG-T kojem nedostaje egzon 7, ali s egzonom 1T, koji promovira promotor PT na suprotnom lancu, kojeg dijeli s onim za SAT2.[16]

Aktivacija promotora[uredi | uredi izvor]

Mehanizam aktiviranja promotora za SHBG u jetri uključuje hepatocitni jedarni faktor 4 alfa (HNF4A) vezanjem za DR1 poput cis-elementa koji zatim stimulira proizvodnju. Natječe se s HNF4A na trećem mjestu promotora PPARG-2, koji smanjuje kopiranje gena u iRNK. Ako je nivo HNF4A nizak, tada se COUP-TF veže na prvo mjesto i isključuje proizvodnju SHBG-a.

Proteini[uredi | uredi izvor]

Globulin koji veže spolni hormon je homodimerni, što znači da ima dva identična peptidna lanca koja čine njegovu strukturu. Sekvenca aminokiselina je ista kao i za androgen-vezujući protein, ali koji ima različite oligosaharide i nastaje u testisima.[13]

SHBG ima dva domena nalik na laminin G, koji čine džepove za vezanje hidrofobnih molekul<. Steroidi su vezani LG-domenom na amino kraju proteina.[5] U džepu domene nalazi se ostatak serina koji privlači dva različita tipa steroida u različitim tačkama, mijenjajući tako njihove orijentacije. Androgeni se vezuju za C3 funkcionalne grupe na A prstenu, a estrogeni se vežu putem hidroksila, vezanog za C17 na D prstenu. Dvije različite orijentacije mijenjaju petlju preko ulaza u džep i položaja trp84 (kod ljudi). Stoga čitav protein signalizira koji hormon nosi na svojoj površini.[5] LG domen koji veže sterode kodira se egzonima 2 do 5.[5] Povezna regija se pridružuje uz dva LG domena zajedno.[5]

Kada je prvi put proizveden, prekursor SHBG imao je vodeći signalni peptid vezan sa 29 aminokiselina. Preostali peptid ima 373 aminokiseline. Postoje dva sumporna mosta.

Šećeri su vezani za dvije različite N-glikolizacijske tačke na asparaginu (351 i 367) i jednu O-glikoliaciju (7) tačke za treonin.[17]

Metali[uredi | uredi izvor]

Za povezivanje dva elementa dimera potreban je ion kalcija. Također se i ion cinka koristi za orijentaciju inače neorganiziranog dijela peptidnog lanca.[5]

Regulacija[uredi | uredi izvor]

SHBG ima i pojačavajući i inhibirajući hormonski uticaj. Smanjuje se visokim nivoima insulina, hormona rasta, insulinu sličnog faktora rasta 1 (IGF-1), androgena, prolaktina i transkortina. Visoki nivoi estrogena i tiroksina uzrokuju njegovo povećanje.

U nastojanju da objasne smanjenje SHBG-a povezano s pretilošću, nedavni dokazi sugeriraju jetrenu lipogenezu, induciranu šećerom ili monosaharidima, lipidima jetre općenito i citokinima . TNF-alfa i interleukin smanjuju SHBG, dok insulin ne. Kao primjer, anti-psorijazni lijekovi koji inhibiraju TNF-alfa uzrokuju povećanje SHBG. Uobičajeni nizvodni mehanizam za sve ove, uključujući učinak hormona štitnjače[18] bila je smanjena regulacija HNF4, hepatocitnog nuklearnog faktora 4.[19][20][21][22]

Krvne razine[uredi | uredi izvor]

Razvijeni su eeferentni opsezi za testove krvi za SHBG:[23][24]

Populacija Razina
Odrasla žena, premenopauza 40–120 nmol/L
Odrasla žena, postmenopauza 28–112 nmol/L
Odrasli muškarac 20–60 nmol/L
Dojenče (1–23 mjeseca) 60–252 nmol/L
Pretpubertetlije (2 –8 godina) 72–220 nmol/L
Žene u pubertetu 36–125 nmol/L
Muškarci u pubertetu 16–100 nmol/L

Klinički značaj[uredi | uredi izvor]

Visok ili nizak nivo[uredi | uredi izvor]

Nivoi spolnih hormona i SHBG tokom trudnoće .[25]
Nivoi SHBG i estradiola tokom trudnoće.[26] Za SHBG linije su srednja i 95 percentila, dok su tačke pojedinačna mjerenja.[26] Za estradiol linija je srednja razina. Isprekidani dijelovi linije su ekstrapolirane.[26]
Kapacitet vezivanja za SHBG tokom trudnoće.[27]

Razine SHBG-a smanjuju androgeni, davanjem anaboličkih steroida,[28] sindrom policistnih jajnika, hipotireoza, pretilost, Cushingov sindrom i akromegalija. Niski nivoi SHBG povećavaju vjerovatnoću za dijabetes tipa 2.[29] Nivo SHBG-a se povećava sa estrogenim stanjima (oralna kontracepcija, trudnoća, hipertireoza, ciroza, anorexia nervosa i određenim droga ma. Dugotrajno ograničenje kalorija od više od 5o% povećava SHBG, dok istovremeno smanjuje slobodni i ukupni testosteron i estradiol. Ograničenje kalorija ne utiče na DHEA-S, koji nema afinitet za SHBG.[30] Sindrom policistnih jajnika povezan je s insulinskom rezistencijom, a višak insulina smanjuje SHBG, što povećava nivo slobodnog testosterona.[31]

U maternici ljudski fetus ima nizak nivo SHBG, što omogućava povećanu aktivnost spolnih hormona. Nakon rođenja, nivo SHBG raste i ostaje na visokom nivou tokom djetinjstva. U pubertetu se nivo SHBG prepolovljuje kod djevojčica, a kod dječaka spušta na četvrtinu. Promjenu u pubertetu pokreće hormon rasta, a njegova pulsibilnost se razlikuje kod dječaka i djevojčica. U trudnica u trećem tromjesečju trudnoće nivo SHBG eskalira na pet do deset puta više od uobičajenog nivoa za ženu. Hipoteza je da ovo štiti od efekta hormona koji proizvodi fetus.

Gojazne djevojčice vjerovatnije će imati ranu menarhu zbog nižih razina SHBG.[5] Anoreksija ili vitka tjelesna građa kod žena dovodi do viših nivoa SHBG, što zauzvrat može dovesti do amenoreja.[5]

Dijabetes tipa 2[uredi | uredi izvor]

Smanjeni nivoi SHBG, a takođe i određeni polimorfizmi gena SHBG, uključeni su u razvoj rezistencije na insulin i dijabetesa tipa 2.[32] Takvi efekti očito uključuju direktno djelovanje na ćelijskom nivou, gdje je postalo očito da ćelijske membrane određenih tkiva sadrže specifične SHBG receptore visokog afiniteta.[33]

Lijekovi[uredi | uredi izvor]

Oralni kontraceptivi koji sadrže etinilestradiol mogu kod žena povećati nivo SHBG za 2–4 puta i smanjiti koncentraciju slobodnog testosterona za 40 do 80%.[34] Mogu se koristiti za liječenje simptoma bolesti hiperandrogenizma, kao što su akne i hirzutizam.[8][34] Neki oralni kontraceptivi, posebno oni koji sadrže visoke doze etinilestradiola (koji se više ne prodaju), mogu povećati nivo SHBG za pet do deset puta.[8]

Neki lijekovi, poput određenih anaboličkih steroida, kao što su mesterolon i danazol i određeni progestini poput levonorgestrel ai noretisterona, imaju visok afinitet za SHBG i mogu se vezati za njega i istisnuti endogene steroide s njega, povećavajući time slobodne koncentracije ovih endogenih steroida.[35][36][37] Procijenjeno je da bi terapeutski nivoi danazola, metiltestosterona, [[fluoksimesterona levonorgestrela i noretisterona zauzimali ili istiskivali testosteron 83–97%, 48–69%, 42–64%, 16– 47% i 4–39% mjesta vezanja za SHBG, dok bi drugi s malim afinitetom za SHBG, poput etinilestradiola, ciproteron-acetata i medroksiprogesteron- acetata, zauzimali ili istiskivali iz testosterona 1% ili manje mjesta vezanja za SHBG.[35][38]

Afinitet 70 lijekova za SHBG i CBG [35]
Spoj Struktura SHBG
RBA (%)
SHBG
K (106 M−1)
CBG
RBA (%)
CBG
K (106 M−1)
Aminoglutethimid Nesteroidni < 0,01 <0,2 <0,1 <0,1
Androstanolon Steroidni 220 5500 1,3 0,83
Betametazon Steroidni <0,01 <0,2 <0,1 <0,1
Holekalciferol Steroidni <0,01 <0,2 <0,1 <0,1
Cimetidin Nesteroidni <0,01 <0,2 <0,1 <0,1
Klomifen Nesteroidni <0,01 <0,2 <0,1 <0,1
Kortizol Steroidni 0,13 1,6 100 76
Kortizon-acetat Steroidni 0,10 1,2 <0,1 <0,1
Ciproteron-acetat Steroidni 0,10 1,2 <0,1 <0,1
Danazol Steroidni 18 240 10 6,5
Deksametazon Steroidni <0,01 <0,2 <0,1 <0,1
Diazoksid Nesteroidni <0,01 <0,2 <0,1 <0,1
Dietilstilbestrol Nesteroidni <0,01 <0,2 <0,1 <0,1
Digitoksin Steroidni <0,01 <0,2 <0,1 <0,1
Digoksin Steroidni <0,01 <0,2 <0,1 <0,1
DL-DOPA Nesteroidni <0,01 <0,2 <0,1 <0,1
Dopamin Nesteroidni <0,01 <0,2 <0,1 <0,1
Enklomifen Nesteroidni <0,01 <0,2 <0,1 <0,1
Epinefrin Nesteroidni <0,01 <0,2 <0,1 <0,1
Estradiol Steroidni 49 680 <0,1 <0,1
Estradiol-benzoat Steroidni 0,70 8,6 <0,1 <0,1
Etinlestradiol Steroidni 0,80 9,9 <0,1 <0,1
Etisteron Steroidni 55 780 0,33 0,21
Fludrokortizon Steroidni <0,01 <0,2 0,74 0,47
Fluoksimesteron Steroidni 4,8 60 <0,1 <0,1
Flutamid Nesteroidni <0,01 <0,2 <0,1 <0,1
Homovanilinska kiselina Nesteroidni <0,01 <0,2 <0,1 <0,1
Hidrokortizon-hemisukcinat Steroidni <0,01 <0,2 8,7 5,6
Indometacin Nesteroidni <0,01 <0,2 <0,1 <0,1
Levonorgestrel Steroidni 31 420 <0,1 <0,1
Medroksiprogesteron Steroidni 0,15 1,9 13 8,1
Medroksiprogesteron-acetat Steroidni 0,08 1,0 6,5 4,2
Melatonin Nesteroidni <0,01 <0,2 <0,1 <0,1
Mesterolon Steroidni 180 3600 <0,1 <0,1
Mestranol Steroidni <0,01 <0,2 <0,1 <0,1
Metoksitriptofol Nesteroidni <0,01 <0,2 <0,1 <0,1
Metildopa Nesteroidni <0,01 <0,2 <0,1 <0,1
Metilserotonin Nesteroidni <0,01 <0.2 <0.1 <0.1
Metiltestosteron Steroidni 39 530 <0.1 <0.1
Metiamid Nesteroidni <0,01 <0,2 <0,1 <0,1
Metribolon Steroidni 1,7 21 0,36 0,23
Metirapon Nesteroidni <0,01 <0,2 <0,1 <0,1
Meksrenon Steroidni <0,01 <0,2 <0,1 <0,1
Nafoksidin Nesteroidni <0,01 <0,2 <0,1 <0,1
Nandrolon Steroidni 5,8 72 0,10 0,63
Norepinefrin Nesteroidni <0,01 <0,2 <0,1 <0,1
Noretisteron Steroidni 11 140 0,28 0,18
Noretinodrel Steroidni 1,3 16 0,16 0,10
Normetanefrin Nesteroidni <0,01 <0,2 <0,1 <0,1
Fenitoin Nesteroidni <0,01 <0,2 <0,1 <0,1
Kalij-kanrenoat Steroidni 0,18 2,2 0,83 0,53
Prednisolon Steroidni 0,04 0,49 59 41
Prednison Steroidni 0,17 2,1 5,0 3,2
Progesteron Steroidni 0,71 8,8 36 24
Promegeston Steroidni 0,007 0,09 0,40 0,25
Prorenon Steroidni 8,2 100 <0,1 <0,1
Rezerpin Nesteroidni <0,01 <0,2 <0,1 <0,1
Rifampin Nesteroidni <0,01 <0,2 <0,1 <0,1
Serotonin Nesteroidni <0,01 <0,2 <0,1 <0,1
Spironolakton Steroidni 0,03 0,37 <0,1 <0,1
Tamoksifen Nesteroidni <0,01 <0,2 <0,1 <0,1
Testolakton Steroidni <0,01 <0,2 <0,1 <0,1
Testosteron Steroidni 100 1600 8,3 5,3
Testosteron-enantat Steroidni 0,007 0,086 <0,1 <0,1
7α-Tioprogesteron Steroidni 0,06 0,74 36 24
7α-Tiospironolakton Steroidni 0,59 7,3 <0,1 <0,1
Tiroksin Nesteroidni <0,01 <0,2 <0,1 <0,1
Trijodotironin Nesteroidni <0,01 <0,2 <0,1 <0,1
Trimetiltrienolon Steroidni 0,90 11 0,11 0,07
Vanililmandelska kiselina Nesteroidni <0,01 <0,2 <0,1 <0,1
Zuklomifen Nesteroidni <0,01 <0,2 <0,1 <0,1
Referentne vrijednosti liganda (100%) za RBA (%) testosterona za SHBG i kortizola za CBG.
Afiniteti 21 progestina za SHBG i CBG[37][39]
Progestogen SHBG (%) CBG (%)
17α-Alil-19-nortestosteron <1 ?
Alilestrenol <1 ?
Hlormadinon-acetat <1 <1
Ciproteron-acetat <1 <1
Dezogestrel <1 <1
Dienogest <1 <1
Drospirenon <1 <1
Etonogestrel 15 <1
Gestoden 40 <1
Levonorgestrel 50 <1
Medroksiprogesteron-acetat <1 <1
Megestrol-acetat <1 <1
Nomegestrol-acetat <1 <1
Norelgestromin <1 ?
Noretisteron 16 <1
Noretinodrel <1 <1
Norgestimat <1 <1
Progesteron <1 36
Promegeston <1 <1
Segesteron-acetat <1 ?
Δ4-Tibolon 1 <1
Vrijednosti su RBAs (%). Referentni ligand]] (100%) za SHBG je dihidrotestosteron a za CBG je kortizol.
Afiniteti 14 AAS za SHBG[36]
Spoj SHBG (%)
5α-Androstan-3β,17β-diol 17
5β-Androstan-3α,17β-diol 5
Dihidrotestosteron 100
Etilestrenol <1
Fluoksimesteron <1
Mesterolon 440
Metandienon 2
Metenolon 3
Metiltestosteron 5
Metribolon <1
Nandrolon 1
Oksimetholon <1
Stanozolol 1
Testosteron 19
Vrijednosti su RBAs (%). Referentni ligand (100%) za SHBG je dihidrotestosteron.
Afiniteti of 41 steroida za SHBG[40]
Spoj SHBG (%)
3β-Androstanediol 100
Androstenediol 77
Bolandiol 24
Dihidroetisteron 100
Dihidroetiltestosteron 18–21
Dihidrometilandrostenediol 77
Dihidronandrolon 44
Dihidrotestosteron 100
Dihidrotrestolon 47
4,17α-Dimetiltestosteron 97
Drostanolon 39
Etisteron 92
Fluoksimesteron 3
11-Ketodihidrotestosteron 0
Medroksiprogesteron.acetat 16
Megestrol-acetat 0
Mestanolon 84
Metasteron 58
Metil-1-testosteron 69
Metilandrostenediol 40
Metiltestosteron 64
Miboleron 6
Nandrolon 16
Nandrolon-dekanoat 0
Nandrolon-fenilpropionat 0
Noretandrolon 3
Noretisteron 21
Normetandron 7
Oksandrolon 0
Oksimetolon 3
Progesteron 13
Stanozolol 36
1-Testosteron 98
Testosteron 82
Testosteron-benzoat 8
Testosteron-cipionat 6
Testosteron-enantat 9
Δ4-Tibolon 8
Trestolon 12
Trestolon-enantat 12
Viniltestosteron 36
Vrijednosti su RBAs (%). Referentni ligand (100%) za SHBG je dihidrotestosteron.
Afiniteti 11 steroida za SHBG i CBG[41]
Spoj SHBG (%) CBG (%)
Aldosteron <0,2 6,0
Kortikosteron <0,2 107
Kortizol <0,2 100
Deksametazon <0,2 <0,1
Dihidrotestosteron 100 0,8
Estradiol 8,7 <0,1
Metribolon 0,2 <0,1
Moksestrol <0,2 <0,1
Progesteron <0,2 25
Promegeston <0,2 0,9
Testosteron 26 3
Vrijednosti su RBA (%). Rferentni ligand (100%) za SHBG je dihidrotestosteron a za CBG jr kortizol.
Afiniteti devet estrogena za SHBG[37][42]
Spoj RBA za
SHBG (%)
Veza sa
SHBG (%)
Veza sa
albumin (%)
17β-Estradiol 50 37 61
Estron 12 16 80
Estriol 0.3 1 91
Estrone-sulfat 0 0 99
17β-Dihidroekvilin 30 ? ?
Ekvilin 8 26 13
17β-Dihidroekvilin-sulfat 0 ? ?
Ekvilin-sulfat 0 ? ?
Δ8-Estron ? ? ?
Referentni ligand (100%) za SHBG RBA (%) vrijdnostui su testosterona.

Endogeni steroidi[uredi | uredi izvor]

Mjerenje[uredi | uredi izvor]

Prilikom provjere serumskog estradiola ili testosterona može se odrediti ukupni nivo koji uključuje slobodne i vezane frakcije ili se slobodni dio može izmjeriti sam. Globulin koji veže spolni hormon može se mjeriti odvojeno od ukupnog udjela testosterona.

Indeks slobodnog androgena izražava odnos testosterona prema SHBG i može se koristiti za sumiranje aktivnosti slobodnog testosterona. Najbolji test za testosteron je biodostupni testosteron.

Afinitet i vezanje[uredi | uredi izvor]

Šablon:Resize
Steroid Afinitet za SHBG Vezanje muških plazmatskih proteina Vezanje ženskih plazmatskih proteina (folikulska faza)
RBA (%) K (106 M−1) Ukupno (nM) Nevezano (%) SHBG (%) CBG (%) Albumin (%) Ukupno (nM) Nevezano (%) SHBG (%) CBG (%) Albumin (%)
Aldosteron 0,017 0,21 0,35 37,1 0,10 21,2 41,6 0,24 36,8 0,23 21,9 41,2
3α-Androstanediol 82 1300 0,41 0,85 13,7 <0,1 85,5 0,068 0,71 27,9 <0,1 71,4
Androstenediol 97 1500 4,3 3,24 60,4 <0,1 36,3 2,4 1,73 78,8 <0,1 19,4
Androstenedion 2,3 29 4,1 7,85 2,82 1,37 88,0 5,4 7,54 6,63 1,37 84,5
Androsteron 1,1 14 2,0 4,22 0,73 0,52 94,5 1,5 4,18 1,77 0,54 93,5
Kortikosteron 0,18 2,2 12 3,39 0,09 77,5 19,0 7,0 3,28 0,22 78,1 18,4
Kortizol 0,13 1,6 400 3,91 0,08 89,5 6,57 400 3,77 0,18 89,7 6,33
Kortizon 0,22 2,7 72 16,2 0,54 38,0 45,3 54 15,8 1,30 38,6 44,3
Dehidroepiandrosteron 5,3 66 24 4,13 3,38 <0,1 92,4 17 3,93 7,88 <0,1 88,1
11-Dezoksikortikosteron 1,9 24 0,20 2,69 0,80 36,4 60,1 0,12 2,62 1,91 36,9 58,6
11-Dezoksikortizol 1,3 16 1,4 3,37 0,67 77,1 18,9 0,60 3,24 1,57 77,1 18,1
Dihidrotestosteron 220 5500 1,7 0,88 59,7 0,22 39,2 0,65 0,47 78,4 0,12 21,0
Estradiol 49 680 0,084 2,32 19,6 <0,1 78,0 0,29 1,81 37,3 <0,1 60,8
Estriol 0,35 4,3 0,037 8,15 0,44 <0,2 91,3 0,10 8,10 1,06 <0,2 90,7
Estron 12 150 0,081 3,96 7,37 <0,1 88,6 0,23 3,58 16,3 <0,1 80,1
Etioholanolon 0,11 1,4 1,3 8,15 0,14 0,44 91,3 1,2 8,13 0,35 0,46 91,1
Pregnenolon 1,1 14 2,4 2,87 0,50 0,16 96,5 2,2 2,85 1,21 0,16 95,8
17α-Hidroksipregnenolon 0,19 2,3 5,4 4,27 0,12 <0,1 95,5 3,5 4,26 0,30 <0,1 95,4
Progesteron 0,71 8,8 0,57 2,39 0,26 17,2 80,1 0,65 2,36 0,63 17,7 79,3
17α-Hidroksiprogesteron 0,8 9,9 5,4 2,50 0,31 41,3 55,9 1,8 2,44 0,73 42,1 54,7
Testosteron 100 1600 23 2,23 44,3 3,56 49,9 1,3 1,36 66,0 2,26 30,4
Kod muškaraca, koncentracije SHBG, CBG i albumina bile su 28 nM, 0,7 μM, odnosno 0,56 mM. Kod žena, koncentracije SHBG, CBG i albumina bile su 37 nM, 0,7 μM, odnosno 0,56 mM.

Sinonimi[uredi | uredi izvor]

SHBG je poznat pod raznim različitim imenima, kao što su:[43][44][45]

  • Globulin vežan za spolni hormon (SHBG)
  • Spolni globulin koji veže steroide (SSBG, SBG)
  • Proteini koji vežu seksualne steroide (SBP, SSBP)
  • Protein koji veže androgen (ABP)
  • Estradiol-vezujući protein (EBP)
  • Testosteron – estradiol koji vežu globulin (TeBG, TEBG)

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000129214 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000005202 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b c d e f g h Hammond GL (septembar 2011). "Diverse roles for sex hormone-binding globulin in reproduction". Biology of Reproduction. 85 (3): 431–41. doi:10.1095/biolreprod.111.092593. PMC 4480437. PMID 21613632.
  6. ^ "UniProt, P04278". Pristupljeno June 18, 2021.
  7. ^ a b Somboonporn W, Davis SR (juni 2004). "Testosterone effects on the breast: implications for testosterone therapy for women". Endocrine Reviews. 25 (3): 374–88. doi:10.1210/er.2003-0016. PMID 15180949.
  8. ^ a b c d e f g h Hammond GL (25. 4. 2017). "Sex Hormone-Binding Globulin and the Metabolic Syndrome". u Winters SJ, Huhtaniemi IT (ured.). Male Hypogonadism: Basic, Clinical and Therapeutic Principles. Humana Press. str. 305–324. doi:10.1007/978-3-319-53298-1_15. ISBN 978-3-319-53298-1.
  9. ^ Becker K, Bilezikian JP, Bremner WJ, Hung W, Kahn CR (24. 4. 2001). Principles and Practice of Endocrinology and Metabolism. Lippincott Williams & Wilkins. ISBN 978-0-7817-1750-2. Pristupljeno 4. 8. 2012.
  10. ^ Buchsbaum HJ (6. 12. 2012). The Menopause. Springer Science & Business Media. str. 62–. ISBN 978-1-4612-5525-3.
  11. ^ Fritz MA, Speroff L (28. 3. 2012). Clinical Gynecologic Endocrinology and Infertility. Lippincott Williams & Wilkins. str. 44–. ISBN 978-1-4511-4847-3.
  12. ^ Hogeveen KN, Cousin P, Pugeat M, Dewailly D, Soudan B, Hammond GL (april 2002). "Human sex hormone-binding globulin variants associated with hyperandrogenism and ovarian dysfunction". J. Clin. Invest. 109 (7): 973–81. doi:10.1172/JCI14060. PMC 150924. PMID 11927624.
  13. ^ a b Hammond GL, Bocchinfuso WP (1996). "Sex hormone-binding globulin: gene organization and structure/function analyses". Hormone Research. 45 (3–5): 197–201. doi:10.1159/000184787. PMID 8964583.
  14. ^ * Bérubé D, Séralini GE, Gagné R, Hammond GL (1991). "Localization of the human sex hormone-binding globulin gene (SHBG) to the short arm of chromosome 17 (17p12----p13)". Cytogenetics and Cell Genetics. 54 (1–2): 65–7. doi:10.1159/000132958. PMID 2249477.
  15. ^ Joseph DR (januar 1998). "The rat androgen-binding protein (ABP/SHBG) gene contains triplet repeats similar to unstable triplets: evidence that the ABP/SHBG and the fragile X-related 2 genes overlap". Steroids. 63 (1): 2–4. doi:10.1016/S0039-128X(97)00087-1. PMID 9437788. S2CID 12825993.
  16. ^ Nakhla AM, Hryb DJ, Rosner W, Romas NA, Xiang Z, Kahn SM (maj 2009). "Human sex hormone-binding globulin gene expression- multiple promoters and complex alternative splicing". BMC Molecular Biology. 10 (1): 37. doi:10.1186/1471-2199-10-37. PMC 2694190. PMID 19416531.
  17. ^ Hammond GL, Underhill DA, Smith CL, Goping IS, Harley MJ, Musto NA, Cheng CY, Bardin CW (maj 1987). "The cDNA-deduced primary structure of human sex hormone-binding globulin and location of its steroid-binding domain". FEBS Letters. 215 (1): 100–4. doi:10.1016/0014-5793(87)80121-7. PMID 3569533. S2CID 23058156.
  18. ^ Selva DM, Hammond GL (juli 2009). "Thyroid hormones act indirectly to increase sex hormone-binding globulin production by liver via hepatocyte nuclear factor-4alpha". Journal of Molecular Endocrinology. 43 (1): 19–27. doi:10.1677/JME-09-0025. PMID 19336534.
  19. ^ Selva DM, Hogeveen KN, Innis SM, Hammond GL (decembar 2007). "Monosaccharide-induced lipogenesis regulates the human hepatic sex hormone-binding globulin gene". The Journal of Clinical Investigation. 117 (12): 3979–87. doi:10.1172/JCI32249. PMC 2066187. PMID 17992261. SažetakPhysOrg.com.
  20. ^ Simó R, Barbosa-Desongles A, Hernandez C, Selva DM (novembar 2012). "IL1β down-regulation of sex hormone-binding globulin production by decreasing HNF-4α via MEK-1/2 and JNK MAPK pathways". Molecular Endocrinology. 26 (11): 1917–27. doi:10.1210/me.2012-1152. PMC 5416961. PMID 22902540.
  21. ^ Simó R, Barbosa-Desongles A, Lecube A, Hernandez C, Selva DM (februar 2012). "Potential role of tumor necrosis factor-α in downregulating sex hormone-binding globulin". Diabetes. 61 (2): 372–82. doi:10.2337/db11-0727. PMC 3266423. PMID 22210320.
  22. ^ Goto A, Morita A, Goto M, Sasaki S, Miyachi M, Aiba N, Terauchi Y, Noda M, Watanabe S (oktobar 2012). "Associations of sex hormone-binding globulin and testosterone with diabetes among men and women (the Saku Diabetes study): a case control study". Cardiovascular Diabetology. 11: 130. doi:10.1186/1475-2840-11-130. PMC 3537568. PMID 23066943.
  23. ^ Unit Code 91215 Archived 2011-07-20 na Wayback Machine a Mayo Clinic Medical Laboratories. Retrieved April 2011
  24. ^ [1]Becker DM (27. 7. 2019). "10 Simple Ways To Lower SHBG (#9 Is Fake News!)".
  25. ^ Kerlan V, Nahoul K, Le Martelot MT, Bercovici JP (februar 1994). "Longitudinal study of maternal plasma bioavailable testosterone and androstanediol glucuronide levels during pregnancy". Clin. Endocrinol. (Oxf). 40 (2): 263–7. doi:10.1111/j.1365-2265.1994.tb02478.x. PMID 8137527. S2CID 40738152.
  26. ^ a b c O'Leary P, Boyne P, Flett P, Beilby J, James I (1991). "Longitudinal assessment of changes in reproductive hormones during normal pregnancy". Clin Chem. 37 (5): 667–72. doi:10.1093/clinchem/37.5.667. PMID 1827758.CS1 održavanje: više imena: authors list (link)
  27. ^ Mean F, Pellaton M, Magrini G (oktobar 1977). "Study on the binding of dihydrotestosterone, testosterone and oestradiol with sex hormone binding globulin". Clin. Chim. Acta. 80 (1): 171–80. doi:10.1016/0009-8981(77)90276-5. PMID 561671.
  28. ^ Ruokonen A, Alén M, Bolton N, Vihko R (juli 1985). "Response of serum testosterone and its precursor steroids, SHBG and CBG to anabolic steroid and testosterone self-administration in man". Journal of Steroid Biochemistry. 23 (1): 33–8. doi:10.1016/0022-4731(85)90257-2. PMID 3160892.
  29. ^ Ding EL, Song Y, Manson JE, Hunter DJ, Lee CC, Rifai N, Buring JE, Gaziano JM, Liu S (septembar 2009). "Sex hormone-binding globulin and risk of type 2 diabetes in women and men". The New England Journal of Medicine. 361 (12): 1152–63. doi:10.1056/NEJMoa0804381. PMC 2774225. PMID 19657112.
  30. ^ Cangemi R, Friedmann AJ, Holloszy JO, Fontana L (april 2010). "Long-term effects of calorie restriction on serum sex-hormone concentrations in men". Aging Cell. 9 (2): 236–42. doi:10.1111/j.1474-9726.2010.00553.x. PMC 3569090. PMID 20096034.
  31. ^ Manni A, Pardridge WM, Cefalu W, Nisula BC, Bardin CW, Santner SJ, Santen RJ (oktobar 1985). "Bioavailability of albumin-bound testosterone". The Journal of Clinical Endocrinology and Metabolism. 61 (4): 705–10. doi:10.1210/jcem-61-4-705. PMID 4040924.
  32. ^ Le TN, Nestler JE, Strauss JF, Wickham EP (januar 2012). "Sex hormone-binding globulin and type 2 diabetes mellitus". Trends in Endocrinology and Metabolism. 23 (1): 32–40. doi:10.1016/j.tem.2011.09.005. PMC 3351377. PMID 22047952.
  33. ^ Rosner W, Hryb DJ, Kahn SM, Nakhla AM, Romas NA (mart 2010). "Interactions of sex hormone-binding globulin with target cells". Molecular and Cellular Endocrinology. 316 (1): 79–85. doi:10.1016/j.mce.2009.08.009. PMID 19698759. S2CID 27912941.
  34. ^ a b IARC Working Group on the Evaluation of Carcinogenic Risks to Humans; World Health Organization; International Agency for Research on Cancer (2007). Combined Estrogen-progestogen Contraceptives and Combined Estrogen-progestogen Menopausal Therapy. World Health Organization. str. 157. ISBN 978-92-832-1291-1.
  35. ^ a b c Pugeat MM, Dunn JF, Nisula BC (juli 1981). "Transport of steroid hormones: interaction of 70 drugs with testosterone-binding globulin and corticosteroid-binding globulin in human plasma". J. Clin. Endocrinol. Metab. 53 (1): 69–75. doi:10.1210/jcem-53-1-69. PMID 7195405.
  36. ^ a b Saartok T, Dahlberg E, Gustafsson JA (1984). "Relative binding affinity of anabolic-androgenic steroids: comparison of the binding to the androgen receptors in skeletal muscle and in prostate, as well as to sex hormone-binding globulin". Endocrinology. 114 (6): 2100–6. doi:10.1210/endo-114-6-2100. PMID 6539197.
  37. ^ a b c Kuhl H (2005). "Pharmacology of estrogens and progestogens: influence of different routes of administration" (PDF). Climacteric. 8 Suppl 1: 3–63. doi:10.1080/13697130500148875. PMID 16112947. S2CID 24616324.
  38. ^ Pugeat MM, Dunn JF, Rodbard D, Nisula BC (decembar 1981). "The significance of drug interactions with human TeBG and CBG under physiological conditions: a new approach". J. Steroid Biochem. 15: 487–90. doi:10.1016/0022-4731(81)90319-8. PMID 7200170.
  39. ^ Bergink EW, Loonen PB, Kloosterboer HJ (august 1985). "Receptor binding of allylestrenol, a progestagen of the 19-nortestosterone series without androgenic properties". Journal of Steroid Biochemistry. 23 (2): 165–8. doi:10.1016/0022-4731(85)90232-8. PMID 3928974.
  40. ^ Cunningham GR, Tindall DJ, Lobl TJ, Campbell JA, Means AR (septembar 1981). "Steroid structural requirements for high affinity binding to human sex steroid binding protein (SBP)". Steroids. 38 (3): 243–62. doi:10.1016/0039-128X(81)90061-1. PMID 7197818. S2CID 2702353.
  41. ^ Ojasoo T, Raynaud JP (novembar 1978). "Unique steroid congeners for receptor studies". Cancer Res. 38 (11 Pt 2): 4186–98. PMID 359134.
  42. ^ Lemke TL, Williams DA (2008). Foye's Principles of Medicinal Chemistry. Lippincott Williams & Wilkins. str. 1306–. ISBN 978-0-7817-6879-5.
  43. ^ "SHBG". GeneCards.
  44. ^ "Sex Steroid-Binding Protein". Steroid-Protein Interactions II. Springer Science & Business Media. 6. 12. 2012. str. 198. ISBN 978-3-642-82486-9.
  45. ^ Westphal U (12. 12. 1994). "Structure, Function, and Regulation of Androgen-Binding Protein?Sex Hormone-Binding Globulin". u Litwack G (ured.). Vitamins and Hormones: Steroids. Academic Press. str. 200. ISBN 978-0-08-086646-8.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Šablon:Prenosni proteini