Plazmin

S Wikipedije, slobodne enciklopedije
Idi na navigaciju Idi na pretragu
PLG
Plasminogenpress.png
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1B2I, 1BML, 1BUI, 1CEA, 1CEB, 1DDJ, 1HPJ, 1HPK, 1I5K, 1KI0, 1KRN, 1L4D, 1L4Z, 1PK4, 1PKR, 1PMK, 1QRZ, 1RJX, 2DOH, 2DOI, 2KNF, 2L0S, 2PK4, 3UIR, 4A5T, 4CIK, 4DCB, 4DUR, 4DUU, 5HPG

Identifikatori
AliasiPLG
Vanjski ID-jeviOMIM: 173350 MGI: 97620 HomoloGene: 55452 GeneCards: PLG
Lokacija gena (čovjek)
Hromosom 6 (čovjek)
Hrom.Hromosom 6 (čovjek)[1]
Hromosom 6 (čovjek)
Genomska lokacija za PLG
Genomska lokacija za PLG
Bend6q26Početak160,702,238 bp[1]
Kraj160,754,097 bp[1]
Lokacija gena (miš)
Hromosom 17 (miš)
Hrom.Hromosom 17 (miš)[2]
Hromosom 17 (miš)
Genomska lokacija za PLG
Genomska lokacija za PLG
Bend17 A1|17 8.5 cMPočetak12,378,608 bp[2]
Kraj12,419,385 bp[2]
Obrazac RNK ekspresije
PBB GE PLG 209978 s at fs.png

PBB GE PLG 209977 at fs.png

PBB GE PLG 205871 at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija apolipoprotein binding
protein domain specific binding
peptidase activity
GO:0001948 protein binding
serine-type peptidase activity
signaling receptor binding
hydrolase activity
serine-type endopeptidase activity
chaperone binding
proteasome core complex binding
protein antigen binding
endopeptidase activity
enzyme binding
kinase binding
Ćelijska komponenta blood microparticle
extracellular region
cell surface
extrinsic component of external side of plasma membrane
Egzosom
platelet alpha granule lumen
Vanćelijsko
Ćelijska membrana
extrinsic component of plasma membrane
intracellular membrane-bounded organelle
collagen-containing extracellular matrix
Biološki proces Hemostaza
negative regulation of cell-substrate adhesion
cellular protein metabolic process
negative regulation of fibrinolysis
negative regulation of cell-cell adhesion mediated by cadherin
platelet degranulation
extracellular matrix disassembly
positive regulation of fibrinolysis
tissue remodeling
negative regulation of cell population proliferation
blood coagulation
Proteoliza
fibrinolysis
positive regulation of blood vessel endothelial cell migration
tissue regeneration
myoblast differentiation
muscle cell cellular homeostasis
proteolysis involved in cellular protein catabolic process
trophoblast giant cell differentiation
labyrinthine layer blood vessel development
mononuclear cell migration
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001168338
NM_000301

NM_008877

RefSeq (bjelančevina)

NP_000292
NP_001161810

NP_032903

Lokacija (UCSC)Chr 6: 160.7 – 160.75 MbChr 17: 12.38 – 12.42 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Plazmin, sa svojim prekursorom zvamim plazminogen, jest značajan enzim (EC: 3.4.21.7) u krvi, koji razlaže mnoge plazmatske proteine, uključujući i fibrin krvnih pločica. Razgradnja fibrina naziva se fibrinoliza. Kod ljudi kodiran je genom PLG.[5]

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 810 aminokiselina, а molekulska težina 90.569 Da.[6]

1020304050
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECA
AKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYL
SECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEEN
YCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKT
MSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDP
NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIP
SCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQS
WSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCN
LKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGT
PCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRK
LYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQ
EIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECF
ITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLA
GGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFV
TWIEGVMRNN

Funkcija[uredi | uredi izvor]

Fibrinoliza: Plave strelice označavaju stimulaciju, a crvene inhibiciju.

Plazmin je serin-proteaza koja djeluje tako darazlaže fibrinske krvne ugruške. Osim fibrinolize, plazminski proteini obavljaju proteolizu u raznim drugim sistemima: aktiviraju kolagenaze, neke posrednike komplementarnog sistema i slabi zid Graafovog folikula , što dovodi do ovulacija. Plazmin je također integralno uključen u upale.[7] On cijepa fibrin, fibronektin, trombospondin, laminin i von Willebrandov faktor. Plazmin, poput tripsina, pripada porodici serin-proteaza.

Plazmin se oslobađa kao zimogen zvan plazminogen (PLG) iz jetre u sistemsku cirkulaciju. Kod ljudi, postoje dvije glavne glikoforme plazminogena – plazminogen tipa I sadrži dva glikozilacijska dijela (N-vezan za N289 i O-vezan za T346), dok plazminogen tipa II sadrži samo jedan O-vezani šećer (O-vezan za T346) . Plazminogen tipa II se prvenstveno regrutuje na ćelijsku površinu u odnosu na glikoformu tipa I. Nasuprot tome, plazminogen tipa I lakše se regrutira u krvne ugruške.

U cirkulaciji, plazminogen ima zatvorenu konformaciju otpornu na aktivaciju. Nakon vezanja za ugruške ili na ćelijsku površinu, plazminogen dobija otvoreni oblik konformacije koji se može pretvoriti u aktivni plazmin. raznim enzimma, uključujući tkivni aktivator plazminogena (tPA), urokinazni aktivator plazminogena (uPA), kalikrein i faktor XII (Hagemanov faktor). Fibrin je kofaktor za aktivaciju plazminogena tkivnim aktivatorom plazminogena. Urokinazni receptor aktivatora plazminogena (uPAR) je kofaktor za aktivaciju plazminogena aktivatorom urokinaze plazminogena. Pretvaranje plazminogena u plazmin uključuje cijepanje peptidne veze između Arg-561 i Val-562.[5][8][9][10]

Cijepanjem plazmina nastaje angiostatin.

Mehanizam aktivacije plazminogena[uredi | uredi izvor]

Plazminogen pune dužine sadrži sedam domena. Osim C-terminalnog domena serin-proteaze sličnog himotripsinu, plazminogen sadrži N-terminalni Pan Appleov domen (PAp), zajedno s pet Kringleovih domena (KR1-5) . Pan-Appleov domen sadrži važne odrednice za održavanje plazminogena u zatvorenom obliku, a Kringleovi domeni odgovorni su za vezivanje za ostatke lizina u receptorima i supstratima.

Rentgenska kristalna struktura zatvorenog plazminogena otkriva da domeni PAp i SP održavaju zatvorenu konformaciju kroz interakcije ostvarene u cijelom nizu Kringleovih domena.[11] Hloridni ioni dalje premošćuju sučelja PAp/KR4 i SP/KR2 , objašnjavajući fiziološku ulogu serumskog hlorida u stabilizaciji zatvorene konformacije. Strukturne studije također otkrivaju da razlike u glikozilaciji mijenjaju položaj KR3. Ovi podaci pomažu u objašnjenju funkcionalnih razlika između glikoformi plazminogena tipa I i tipa II.

U zatvorenoj konformaciji plazminogena, pristup aktivacijskoj vezi (R561/V562) ciljanoj cijepanjem pomoću tPA i uPA blokiran je kroz položaj sekvence linkera KR3/KR4 i O-vezanog šećera na T346. Položaj KR3 može također ometati pristup aktivacijskoj petlji. Interakcije između domena također blokiraju sva mjesta vezanja Kringleovog liganda osim onog KR-1, što sugerira da potonji domen upravlja regrutovanjem proenzima za ciljeve. Analiza srednje strukture plazminogena sugerira da se konformacijska promjena plazminogena u otvoreni oblik inicira kroz KR-5 prolazno se skidajući od domena PAp. Ovi pokreti izlažu mjesto vezanja lizina KR5 potencijalnim partnerima vezanja i predlažu zahtjev za prostorno različitim ostacima lizina u izazivanju regrutiranja plazminogena i konformacijske promjene.[11]

Mehanizam inaktivacije plazmina[uredi | uredi izvor]

Plazmin se inaktivira proteinima kao što su α2-makroglobulin i α2-antiplazmin.[12] Mehanizam inaktivacije plazmina uključuje cijepanje α2-makroglobulina u regiji mamca (segment aM-a koji je posebno osjetljiv na proteolitsko cijepanje) putem plazmina. Ovo inicira konformacijsku promjenu, tako da se α2-makroglobulin ppostavlja oko plazmina. U rezultirajućem kompleksu α2-makroglobulin-plazmin, aktivno mjesto plazmina je sterno zaštićeno, čime se značajno smanjuje pristup plazmina proteinskim supstratima. Dva dodatna događaja dešavaju se kao posljedica cijepanja regije mamaca, i to (1) h-cisteinil-g-glutamil tiol ester α2-makroglobulin postaje visoko reaktivan i (2) velika konformacijska promjena izlaže konzervirano COOH-terminalno vezanje receptorskog domena. Izloženost ovog domena koji veže receptore omogućava kompleksu α2-makroglobulinske proteaze da se veže za receptore klirensa i ukloni iz cirkulacije.

Klinički značaj[uredi | uredi izvor]

Nedostatak plazmina može dovesti do tromboza, jer ugrušci nisu adekvatno razgrađeni. Nedostatak plazminogena kod miševa dovodi do oštećenja jetre,[13] neispravnog zarastanja rana, reproduktivne abnormalnosti.

Kod ljudi je rijedak poremećaj koji se naziva nedostatak plazminogena tip I (OMIM: 217090) uzrokovan mutacijama PLG gena i često se manifestira lignusni konjunktivitis.

Interakcije[uredi | uredi izvor]

Pokazalo se da plazmin ima interakcije sa:

Reference[uredi | uredi izvor]

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000122194 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000059481 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b "Entrez Gene: plasminogen".
  6. ^ "UniProt, P00747" (jezik: engleski). Pristupljeno 9. 10. 2021.
  7. ^ Atsev S, Tomov N (decembar 2020). "Using antifibrinolytics to tackle neuroinflammation". Neural Regeneration Research. 15 (12): 2203–2206. doi:10.4103/1673-5374.284979. PMC 7749481. PMID 32594031.
  8. ^ Miyata T, Iwanaga S, Sakata Y, Aoki N (oktobar 1982). "Plasminogen Tochigi: inactive plasmin resulting from replacement of alanine-600 by threonine in the active site". Proc. Natl. Acad. Sci. U.S.A. 79 (20): 6132–6. Bibcode:1982PNAS...79.6132M. doi:10.1073/pnas.79.20.6132. PMC 347073. PMID 6216475.
  9. ^ Forsgren M, Råden B, Israelsson M, Larsson K, Hedén LO (mart 1987). "Molecular cloning and characterization of a full-length cDNA clone for human plasminogen". FEBS Lett. 213 (2): 254–60. doi:10.1016/0014-5793(87)81501-6. PMID 3030813. S2CID 9075872.
  10. ^ Law RH, Caradoc-Davies T, Cowieson N, Horvath AJ, Quek AJ, Encarnacao JA, Steer D, Cowan A, Zhang Q, Lu BG, Pike RN, Smith AI, Coughlin PB, Whisstock JC (2012). "The X-ray crystal structure of full-length human plasminogen". Cell Rep. 1 (3): 185–90. doi:10.1016/j.celrep.2012.02.012. PMID 22832192.
  11. ^ a b Law RH, Caradoc-Davies T, Cowieson N, Horvath AJ, Quek AJ, Encarnacao JA, Steer D, Cowan A, Zhang Q, Lu BG, Pike RN, Smith AI, Coughlin PB, Whisstock JC (2012). "The X-ray crystal structure of full-length human plasminogen". Cell Rep. 1 (3): 185–90. doi:10.1016/j.celrep.2012.02.012. PMID 22832192.
  12. ^ Wu, Guojie; Quek, Adam J.; Caradoc-Davies, Tom T.; Ekkel, Sue M.; Mazzitelli, Blake; Whisstock, James C.; Law, Ruby H.P. (5. 3. 2019). "Structural studies of plasmin inhibition". Biochemical Society Transactions. 47 (2): 541–557. doi:10.1042/bst20180211. ISSN 0300-5127. PMID 30837322.
  13. ^ Bezerra JA, Bugge TH, Melin-Aldana H, Sabla G, Kombrinck KW, Witte DP, Degen JL (21. 12. 1999). "Plasminogen deficiency leads to impaired remodeling after a toxic injury to the liver". Proc. Natl. Acad. Sci. U.S.A. Proceedings of the National Academy of Sciences of the United States of America. 96 (26): 15143–8. Bibcode:1999PNAS...9615143B. doi:10.1073/pnas.96.26.15143. PMC 24787. PMID 10611352.
  14. ^ Silverstein RL, Leung LL, Harpel PC, Nachman RL (novembar 1984). "Complex formation of platelet thrombospondin with plasminogen. Modulation of activation by tissue activator". J. Clin. Invest. 74 (5): 1625–33. doi:10.1172/JCI111578. PMC 425339. PMID 6438154.
  15. ^ DePoli P, Bacon-Baguley T, Kendra-Franczak S, Cederholm MT, Walz DA (mart 1989). "Thrombospondin interaction with plasminogen. Evidence for binding to a specific region of the kringle structure of plasminogen". Blood. 73 (4): 976–82. doi:10.1182/blood.V73.4.976.976. PMID 2522013.
  16. ^ Wiman B, Collen D (septembar 1979). "On the mechanism of the reaction between human alpha 2-antiplasmin and plasmin". J. Biol. Chem. 254 (18): 9291–7. doi:10.1016/S0021-9258(19)86843-6. PMID 158022.
  17. ^ Shieh BH, Travis J (maj 1987). "The reactive site of human alpha 2-antiplasmin". J. Biol. Chem. 262 (13): 6055–9. doi:10.1016/S0021-9258(18)45536-6. PMID 2437112.
  18. ^ Campbell PG, Durham SK, Suwanichkul A, Hayes JD, Powell DR (august 1998). "Plasminogen binds the heparin-binding domain of insulin-like growth factor-binding protein-3". Am. J. Physiol. 275 (2 Pt 1): E321-31. doi:10.1152/ajpendo.1998.275.2.E321. PMID 9688635.
  19. ^ Marcos-Contreras OA, Martinez de Lizarrondo S, Bardou I, Orset C, Pruvost M, Anfray A, Frigout Y, Hommet Y, Lebouvier L, Montaner J, Vivien D, Gauberti M (august 2016). "Hyperfibrinolysis increases blood brain barrier permeability by a plasmin and bradykinin-dependent mechanism". Blood. 128 (20): 2423–2434. doi:10.1182/blood-2016-03-705384. PMID 27531677.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Ovaj članak uključuje tekst iz United States National Library of Medicine, koji je u public domain-u.