SERPINA1

S Wikipedije, slobodne enciklopedije
SERPINA1
Alpha 1-antitrypsin.png
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1ATU, 1D5S, 1EZX, 1HP7, 1IZ2, 1KCT, 1OO8, 1OPH, 1PSI, 1QLP, 1QMB, 2D26, 2QUG, 3CWL, 3CWM, 3DRM, 3DRU, 3NDD, 3NDF, 3NE4, 3T1P, 7API, 8API, 9API, 4PYW, 5IO1

Identifikatori
AliasiSERPINA1
Vanjski ID-jeviOMIM: 107400 MGI: 891968 HomoloGene: 20103 GeneCards: SERPINA1
Lokacija gena (čovjek)
Hromosom 14 (čovjek)
Hrom.Hromosom 14 (čovjek)[1]
Hromosom 14 (čovjek)
Genomska lokacija za SERPINA1
Genomska lokacija za SERPINA1
Bend14q32.13Početak94,376,747 bp[1]
Kraj94,390,693 bp[1]
Lokacija gena (miš)
Hromosom 12 (miš)
Hrom.Hromosom 12 (miš)[2]
Hromosom 12 (miš)
Genomska lokacija za SERPINA1
Genomska lokacija za SERPINA1
Bend12 E|12 52.98 cMPočetak103,729,853 bp[2]
Kraj103,739,851 bp[2]
Obrazac RNK ekspresije
PBB GE SERPINA1 202833 s at fs.png

PBB GE SERPINA1 211429 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija peptidase inhibitor activity
protease binding
GO:0001948, GO:0016582 protein binding
identical protein binding
serine-type endopeptidase inhibitor activity
Ćelijska komponenta Golđijev aparat
endoplasmic reticulum lumen
COPII-coated ER to Golgi transport vesicle
Egzosom
endoplasmic reticulum-Golgi intermediate compartment membrane
platelet alpha granule lumen
extracellular region
Endoplazmatski retikulum
Golđijeva membrana
Vanćelijsko
intracellular membrane-bounded organelle
ficolin-1-rich granule lumen
collagen-containing extracellular matrix
Biološki proces Hemostaza
negative regulation of peptidase activity
platelet degranulation
endoplasmic reticulum to Golgi vesicle-mediated transport
COPII vesicle coating
acute-phase response
negative regulation of endopeptidase activity
Koagulacija (krv)
neutrophil degranulation
Posttranslacione modifikacije
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_001127707
NM_000295
NM_001002235
NM_001002236
NM_001127700

NM_001127701
NM_001127702
NM_001127703
NM_001127704
NM_001127705
NM_001127706

NM_009246

RefSeq (bjelančevina)
NP_000286
NP_001002235
NP_001002236
NP_001121172
NP_001121173

NP_001121174
NP_001121175
NP_001121176
NP_001121177
NP_001121178
NP_001121179

NP_033272
NP_001239498
NP_033269

Lokacija (UCSC)Chr 14: 94.38 – 94.39 MbChr 12: 103.73 – 103.74 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Alfa-1 antitripsin ili α1-antitripsin (A1AT, α1AT, A1A ili AAT) je protein serpinske superporodice. Kod ljudi kodiran je genom SERPINA1. Kao inhibitor proteaza, znan je kao alfa1–proteinazni inhibitor (A1PI) ili alfa1-antiproteinaza (A1AP) jer inhibira razne proteaze (ne samo tripsin).[5] U starijoj biomedicinskoj literaturi ponekad se nazivao ""serumski inhibitor tripsina"" (STI, datirana terminologija), jer je njegova sposobnost inhibicije tripsina bila istaknuta karakteristika njegovog ranog proučavanja. Kao tip inhibitora enzima, štiti tkiva od enzimskih upalnih ćelija, posebno neutrofilna elastaza i ima referentni raspon za krvne pretrage od 0,9–2,3 g/L (u SAD-u je referentni raspon izražen u mg/dL ili mikromolima), ali koncentracija se može višestruko povećati nakon akutne upale.[6]

Kada krv sadrži neadekvatne količine A1AT ili funkcionalno oštećene A1AT (kao što je nedostatak alfa-1-antitripsina), neutrofilna elastaza se pretjerano slobodno razgrađuje elastin , degradirajući elastičnost pluća, što dovodi do respiratorne komplikacije, kao što je hronična opstruktivna plućna bolest, kod odraslih. Normalno, A1AT napušta mjesto porijekla, jetru i pridružuje se u sistemsku cirkulaciju; neispravan A1AT to ne može učiniti, nakupljajući se u jetri, što rezultira cirozom bilo kod odraslih ili djece.

Osim što se veže na neutrofilnu elastazu koju oslobađaju upalne ćelije, A1AT se također veže na elastazu lokaliziranu na površini ćelije, u kojem slučaju elastaza ne djeluje kao enzim, već djeluje tako da signalizira ćelijama da se kreću.[7] Osim ćelija jetre, A1PI se proizvodi u koštanoj srži, limfocitnim i monocitnim ćelijama u limfoidnom tkivu i Panethovim ćelijama crijeva.[8]

Inaktivacija A1AT drugim enzimima osim elastaze zbog upale/infekcije uzrokuje zaustavljanje migracije T-ćelija upravo na mjestu gdje postoji patološka uvreda. Ovo ukazuje na ulogu α1PI ne samo u kretanju limfocita kroz tkivo, već kao posljedicu infekcije, primarnu ulogu kao čuvara u imunskoj budnosti.[9]

A1AT je i endogeni inhibitor proteaza i egzogeni oblik, koji se koristi kao lijek. Farmaceutski oblik je prečišćen iz krvi dobrovoljnih davatelja i prodaje se pod nezaštićenim nazivom alfa1inhibitor proteinaze (ljudski) i pod različitim trgovačkim nazivima (uključujući Aralast NP, Glassia, Prolastin, Prolastin-C i Zemaira). Rekombinantne verzije su također dostupne, ali se trenutno koriste u medicinskim istraživanjima više nego kao lijekovi.

Aminokiselinska sekvenca[uredi | uredi izvor]

Dužina polipeptidnog lanca je 418 aminokiselina, a molekulska težina 46.737 Da.[10].

1020304050
MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKI
TPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEI
LEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKL
VDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKEL
DRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGM
FNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFL
ENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAP
LKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIE
QNTKSPLFMGKVVNPTQK
Simboli

Funkcija[uredi | uredi izvor]

U medicini, A1AT je 52-kDa serpin i smatra se najistaknutijim serpinom; termini α1-antitripsin i inhibitor proteaze (Pi) često se koriste naizmjenično.

Većina serpina inaktivira enzim vezujući se za njih kovalentno. Ovi enzimi se lokalno oslobađaju u relativno niskim koncentracijama, gdje ih odmah uklanjaju proteini poput A1AT. U reakciji akutne faze potrebno je dodatno povišenje, kako bi se "ograničilo" oštećenje uzrokovano aktiviranim neutrofilnim granulocitima i njihovim enzimom elastaza, koji razgrađuje vlakno elastin.

Osim što ograničava aktivnost elastaze, kako bi ograničio razgradnju tkiva, A1PI također djeluje inducirajući kretanje limfocita kroz tkivo, uključujući nezrele T-ćelije kroz timus, gdje nezrele T-ćelije sazrijevaju da postanu imunokompetentne T-ćelije, koje se oslobađaju u tkivo kako bi podigle imunsku reakciju.[11]

Kao i svi serinski proteazni inhibitori, A1AT ima karakteristike strukture od beta-listova i alfa-heliksa. Mutacije u ovim područjima mogu dovesti do nefunkcionalnih proteina koji mogu polimerizirati i akumulirati seu jetri (infantilna jetrena ciroza).

Uloga u bolesti[uredi | uredi izvor]

Alfa-1 antitripsin (bijeli) s istaknutim 'reaktivnim središnjim petljom' (plavo) i A-listom (svijetlo plavo). (PDB: 1QLP)

Poremećaji ovog proteina uključuju nedostatak alfa 1-antitripsina, autosomni kodominantni nasljedni poremećaj kod kojeg nedostatak alfa- 1 antitripsin dovodi do hronične nesmetne razgradnje tkiva. To uzrokuje degradaciju posebno plućnog tkiva i na kraju dovodi do karakterističnih manifestacija plućnog emfizema.[12] Dokazi pokazuju da[13] dim cigareta može dovesti do oksidacije metionina 358 α1 -antitripsina (382 u prethodno obrađenom obliku koji sadrži signalni peptid od 24 aminokiseline), ostatak bitan za vezivanje elastaze; smatra se da je ovo jedan od primarnih mehanizama pomoću kojih pušenje (ili pasivno pušenje) može dovesti do emfizema. Budući da se A1AT eksprimira u jetri, određene mutacije u genu koji kodiraj protein mogu uzrokovati pogrešno savijanje proteina i poremećenu sekreciju, što može dovesti do ciroze jetre.

Izuzetno rijedak oblik Pi, zvani Pi Pittsburgh , funkcionira kao antitrombin (srodni serpin), zbog mutacije (Met 358 Arg). Zabilježeno je da je jedna osoba s ovom mutacijom umrla od krvareće dijateze.[14]

Biopsija jetre pokazuje bogate PAS-pozitivne globule unutar periportnih hepatocita.

Utvrđeno je da pacijenti sa reumatoidnim artritisom (RA) stvaraju autoantitijela prema karbamiliranim oblicima A1AT u sinovijalnoj tečnosti. Ovo sugerira da A1AT može imati protivupalnu ili zaštitnu ulogu izvan pluća. Ova antitijela povezana su sa težim tokom bolesti, mogu se posmatrati godinama prije početka bolesti i mogu predvidjeti razvoj RA kod pacijenata sa artralgijom. Zbog toga se karbamilirani A1AT razvija kao antigenski biomarker za RA.[15]

Genetika[uredi | uredi izvor]

Gen se nalazi na dugom kraku hromosoma 14 (sekvenca 14q32.1).

U različitim populacijama, opisano je preko 100 različitih varijanti α-antitripsina. Sjeverozapadni evropski najveći su rizik za nositeljstvo jednog od najčešćih mutantskih oblika A1AT, mutacije Z (Glu342Lys na M1A, rs28929474).

Biohemijska svojstva[uredi | uredi izvor]

A1AT je jednolančani glikoprotein, koji se sastoji od 394 aminokiseline u zrelom obliku i pokazuje mnoge glikoforme. Tri N-vezana mjesta glikozilacije uglavnom su opremljena takozvanim prehrambenim N-glikanima. Međutim, jedno posebno mjesto pokazuje značajnu količinu heterogenosti jer se tri–, pa čak i tetraantenarni N-glikani mogu vezati za asparagin 107 (UniProtKB aminokiselinska nomenklatura). Ovi glikani nose različite količine negativno nabijenih sijalinskih kiselina; to uzrokuje heterogenost uočenu na normalnom A1AT-u, kada se analizira pomoću izoelektričnog fokusiranja. Također, pokazano je da fukosilirani triantenarni N-glikani imaju fukozu kao dio takozvanog sijalil Lewis x epitopa,[16] što bi ovom proteinu moglo dati posebna svojstva prepoznavanja proteinskih ćelija. Utvrđeno je da je pojedinačni cisteinski ostatak A1AT na položaju 256 (UniProtKB nomenklatura) kovalentno povezan sa slobodnim pojedinačnim cisteinom, pomoću disulfidnog mosta.[16]

Analiza[uredi | uredi izvor]

Nivo A1AT u serumu najčešće se određuje dodavanjem antitijela koje se veže za A1AT, zatim pomoću turbidimetrije za mjerenje količine A1AT. Druge metode detekcije uključuju upotrebu testova imuno-sorbenata povezanih s enzimima i radijalnu imunodifuziju.

Za određivanje fenotipa A1AT koriste se različite analitičke metode. Kako elektroforeza proteina nije precizna, fenotip A1AT se analizira pomoću izoelektričnog fokusiranja (IEF), u rasponu pH 4,5-5,5, gdje protein migrira u gelu prema svojoj izoelektričnoj tački ili naboju u gradijentu pH.

Uobičajeni A1AT naziva se M, jer migrira prema centru takvog IEF gela. Druge varijante su manje funkcionalne i nazivaju se A-L i N-Z, ovisno o tome prolaze li proksimalno ili distalno od M pojasa. Prisustvo devijantnih traka na IEF-u može ukazivati na prisustvo nedostak alfa 1-antitripsina. Budući da je broj identificiranih mutacija premašio broj slova u abecedi, najnovijim otkrićima u ovoj oblasti dodani su indeksi, kao u gore opisanoj mutaciji u Pittsburghu.

Kako svaka osoba ima dvije alelne kopije gena A1AT, heterozigot s dvije različite kopije gena može imati dvije različite trake koje se pokazuju na elektrofokusiranju, iako će heterozigot sa jednim nultim mutantom koji dokine ekspresiju gena pokazati samo jedan pojas.

U rezultatima testiranja krvi, rezultati IEF-a su označeni kao u Pi MM, gdje Pi znači inhibitor proteaze i MM je obrazac povezivanja tog pacijenta.

Nivoi alfa-1 antitripsina u krvi zavise od genotipa. Neki mutirani oblici ne uspijevaju se pravilno saviti i, prema tome, ciljaju se na uništavanje u proteasomu, dok drugi imaju tendenciju da polimeriziraju, zadržavajući se u endoplazmatskom retikulumu. Serumski nivoi nekih uobičajenih genotipova su:

  • PiMM: 100% (normalno)
  • PiMS: 80% normalnog serumskog nivoa A1AT
  • PiSS: 60% normalnog serumskog nivoa A1AT
  • PiMZ: 60% normalnog serumskog nivoa A1AT
  • PiSZ: 40% normalnog serumskog nivoa A1AT
  • PiZZ: 10-15% (ozbiljan nedostatak alfa 1-antitripsina)
  • PiZ je uzrokovan mutacijom glutamata do lizina na poziciji 342 (366 u prethodno obrađenom obliku)
  • PiS je uzrokovan mutacijom glutamata do valina na položaju 264 (288 u prethodno obrađenom obliku)

Opisani su i drugi rjeđi oblici; ukupno postoji preko 80 varijanti.

Medicinska upotreba[uredi | uredi izvor]

{{{Naziv lijeka}}}
Naziv lijeka{{{Naziv lijeka}}}
Grupa{{{Grupa}}}
Klasifikacija
Stručne informacije
Hemijske osobine
nema formule
Ime po IUPAC ---
Farmakokinetičke osobine

Alfa-1 antitripsinski koncentrati se pripremaju iz krvne plazme davatelja krvi. Američka Uprava za hranu i lijekove (FDA) odobrila je upotrebu četiri alfa-1 antitripsinska proizvoda dobivena iz ljudske plazme: Prolastin, Zemaira, Glassia i Aralast.[17][18][19][20][21][22] Ovi proizvodi za intravenoznu augmentacijsku terapiju A1AT mogu koštati i do 100.000 USD godišnje po pacijentu.[23] Primjenjuju se intravenozno u dozi od 60 mg/kg jednom sedmično; veće doze ne pružaju dodatnu korist, iako se mogu koristiti u očekivanju prekida sedmične primjene, naprimjer za godišnji odmor.[24]

Inhibitor alfa1-proteinaze (Respreeza) odobren je za medicinsku upotrebu u Evropskoj uniji u septembru 2015.[25] Indiciran je za održavanje, kako bi se usporilo napredovanje emfizema kod odraslih osoba s dokumentiranim teškim nedostatkom inhibitora alfa1-proteinaze (npr. genotipovi PiZZ, PiZ (nula), Pi (nula, nula),PiSZ).[25] Ljudi trebaju biti pod optimalnim farmakološkim i nefarmakološkim tretmanom i pokazati dokaze o progresivnoj plućnoj bolesti (npr. predviđeni manji volumen prisilnog izdisaja u sekundi (FEV1), smanjenu sposobnost hodanja ili povećan broj egzacerbacija) prema procjeni zdravstvenog radnika sa iskustvom u liječenje nedostatka inhibitora alfa1-proteinaze.[25]

Najčešće nuspojave uključuju omaglicu, glavobolju, dispneju (otežano disanje) i mučninu.[25] Tokom liječenja primijećene su alergijske reakcije, od kojih su neke bile teške.[25]

Proučava se terapija A1AT povećanim aerosolom. Ovo uključuje udisanje prečišćenog ljudskog A1AT u pluća i hvatanje A1AT-a u donji respiratorni trakt. Međutim, inhalirani A1AT možda neće doći do elastinskih vlakana u plućima, gdje dolazi do ozljede elastaze. Dodatne studije su u toku. Rekombinantni alfa-1 antitripsin još nije dostupan za upotrebu kao lijek, ali je u razvoju.

Historija[uredi | uredi izvor]

Axelsson i Laurell prvi su (1963.) proučavali mogućnost alelnih varijanti A1AT-akoje se vežu za bolest.[26]

Reference[uredi | uredi izvor]

  1. ^ a b c ENSG00000277377 GRCh38: Ensembl release 89: ENSG00000197249, ENSG00000277377 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000071177 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Gettins PG (December 2002). "Serpin structure, mechanism, and function". Chemical Reviews. 102 (12): 4751–804. doi:10.1021/cr010170. PMID 12475206.
  6. ^ Kushner, Mackiewicz A (1993). The acute phase response: an overview. Acute-phase glycoproteins: molecular biology, biochemistry and clinical applications. CRC Press. str. 3–19.
  7. ^ Guttman O, Baranovski BM, Schuster R, Kaner Z, Freixo-Lima GS, Bahar N, Mizrahi MI, Brami I, Ochayon DE, Lewis EC (February 2015). "Acute-phase protein α1-anti-trypsin: diverting injurious innate and adaptive immune responses from non-authentic threats". Clinical & Experimental Immunology. 179 (2): 161–172. doi:10.1111/cei.12476. PMC 4298394. PMID 25351931.
  8. ^ Winkler IG, Hendy J, Coughlin P, Horvath A, Lévesque JP (April 2005). "Serine protease inhibitors serpina1 and serpina3 are down-regulated in bone marrow during hematopoietic progenitor mobilization". The Journal of Experimental Medicine. 201 (7): 1077–88. doi:10.1084/jem.20042299. PMC 2213124. PMID 15795238.
  9. ^ Richler R, Forssmann W, Henschler R (June 2017). "Current developments in mobilization of hematopoietic stem and progenitor cells and their interaction with nicehes in bone marrow". Transfus Med Hemother. 44 (3): 151–164. doi:10.1159/000477262. PMC 5473067. PMID 28626366.
  10. ^ "UniProt, P01009". Pristupljeno 2021-07-28. CS1 održavanje: nepreporučeni parametar (link)
  11. ^ Lapidot T, Petit I (September 2012). "Current understanding of stem cell mobilization: the roles of chemokines, proteolytic enzymes, adhesion molecules, cytokines, and stromal cells". Exp Hematol. 30 (9): 973–981. doi:10.1016/s0301-472x(02)00883-4. PMID 12225788.
  12. ^ DeMeo DL, Silverman EK (March 2004). "Alpha1-antitrypsin deficiency. 2: genetic aspects of alpha(1)-antitrypsin deficiency: phenotypes and genetic modifiers of emphysema risk". Thorax. 59 (3): 259–64. doi:10.1136/thx.2003.006502. PMC 1746953. PMID 14985567.
  13. ^ Taggart C, Cervantes-Laurean D, Kim G, McElvaney NG, Wehr N, Moss J, Levine RL (September 2000). "Oxidation of either methionine 351 or methionine 358 in alpha 1-antitrypsin causes loss of anti-neutrophil elastase activity". The Journal of Biological Chemistry. 275 (35): 27258–65. doi:10.1074/jbc.M004850200. PMID 10867014.
  14. ^ Owen MC, Brennan SO, Lewis JH, Carrell RW (September 1983). "Mutation of antitrypsin to antithrombin. alpha 1-antitrypsin Pittsburgh (358 Met leads to Arg), a fatal bleeding disorder". The New England Journal of Medicine. 309 (12): 694–8. doi:10.1056/NEJM198309223091203. PMID 6604220.
  15. ^ Verheul MK, Yee A, Seaman A, Janssen GM, van Veelen PA, Drijfhout JW, Toes RE, Mahler M, Trouw LA (June 2017). "Identification of carbamylated alpha 1 anti-trypsin (A1AT) as an antigenic target of anti-CarP antibodies in patients with rheumatoid arthritis". Journal of Autoimmunity. 80: 77–84. doi:10.1016/j.jaut.2017.02.008. PMID 28291659.
  16. ^ a b Kolarich D, Weber A, Turecek PL, Schwarz HP, Altmann F (June 2006). "Comprehensive glyco-proteomic analysis of human alpha1-antitrypsin and its charge isoforms". Proteomics. 6 (11): 3369–80. doi:10.1002/pmic.200500751. PMID 16622833. S2CID 25498702.
  17. ^ "Aralast NP". U.S. Food and Drug Administration (FDA). 22 July 2017. Pristupljeno 11 May 2020.
  18. ^ "Aralast". U.S. Food and Drug Administration (FDA). 22 July 2017. Pristupljeno 11 May 2020.
  19. ^ "Glassia". U.S. Food and Drug Administration (FDA). 22 July 2017. Pristupljeno 11 May 2020.
  20. ^ "Prolastin". U.S. Food and Drug Administration (FDA). 5 March 2018. Pristupljeno 11 May 2020.
  21. ^ "Prolastin-C". U.S. Food and Drug Administration (FDA). 21 September 2017. Pristupljeno 11 May 2020.
  22. ^ "Zemaira". U.S. Food and Drug Administration (FDA). 22 July 2017. Pristupljeno 11 May 2020.
  23. ^ Alkins SA, O'Malley P (March 2000). "Should health-care systems pay for replacement therapy in patients with alpha(1)-antitrypsin deficiency? A critical review and cost-effectiveness analysis". Chest. 117 (3): 875–80. doi:10.1378/chest.117.3.875. PMID 10713018.
  24. ^ Brantly, Mark L.; Lascano, Jorge E.; Shahmohammadi, Abbas (2018-11-28). "Intravenous Alpha-1 Antitrypsin Therapy for Alpha-1 Antitrypsin Deficiency: The Current State of the Evidence". Chronic Obstructive Pulmonary Diseases. 6 (1): 100–114. doi:10.15326/jcopdf.6.1.2017.0185. PMC 6373587. PMID 30775428.
  25. ^ a b c d e "Respreeza EPAR". European Medicines Agency (EMA). 17 September 2018. Pristupljeno 11 May 2020. Ovaj članak sadrži tekst iz ovog izvora, koji je u javnom vlasništvu.
  26. ^ Axelsson U, Laurell CB (November 1965). "Hereditary variants of serum alpha-1-antitrypsin". American Journal of Human Genetics. 17 (6): 466–72. PMC 1932630. PMID 4158556.

Dopunska literatura[uredi | uredi izvor]

Vanjski linkovi[uredi | uredi izvor]

Šablon:Serpini Šablon:Alfa globulini Šablon:Akutna faza proteina Šablon:Antiemoragici